Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 7363..7616 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP074118 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain kpn-hnqyy | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | KGB32_RS27870 | Protein ID | WP_001312851.1 |
| Coordinates | 7363..7512 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 7557..7616 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KGB32_RS27835 (2722) | 2722..3137 | - | 416 | Protein_4 | IS1-like element IS1B family transposase | - |
| KGB32_RS27840 (3386) | 3386..3787 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| KGB32_RS27845 (3720) | 3720..3977 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| KGB32_RS27850 (4070) | 4070..4723 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| KGB32_RS27855 (5662) | 5662..6519 | - | 858 | WP_142295464.1 | incFII family plasmid replication initiator RepA | - |
| KGB32_RS28870 (6538) | 6538..6716 | - | 179 | Protein_9 | protein CopA/IncA | - |
| KGB32_RS27865 (6831) | 6831..7079 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| KGB32_RS27870 (7363) | 7363..7512 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (7557) | 7557..7616 | + | 60 | NuclAT_0 | - | Antitoxin |
| - (7557) | 7557..7616 | + | 60 | NuclAT_0 | - | Antitoxin |
| - (7557) | 7557..7616 | + | 60 | NuclAT_0 | - | Antitoxin |
| - (7557) | 7557..7616 | + | 60 | NuclAT_0 | - | Antitoxin |
| KGB32_RS27875 (7817) | 7817..8149 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| KGB32_RS27880 (8211) | 8211..8810 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| KGB32_RS27885 (9196) | 9196..9396 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| KGB32_RS27890 (9528) | 9528..10088 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| KGB32_RS27895 (10143) | 10143..10889 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| KGB32_RS27900 (10909) | 10909..11109 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| KGB32_RS27905 (11134) | 11134..11838 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| KGB32_RS27910 (11844) | 11844..11984 | + | 141 | WP_001044210.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-65 / blaKPC-2 | - | 1..116047 | 116047 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T201496 WP_001312851.1 NZ_CP074118:c7512-7363 [Klebsiella pneumoniae subsp. pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T201496 NZ_CP098461:3789-4067 [Neisseria gonorrhoeae]
ATGTACGCGATTTCTTTTGATTTGGTGGTTGCCGATACCGCTCAAAACCATCCGAAAGGCATTTCCCAAGCCTACGCGGA
TATTGGATACACCCTGCGGAAATTCGGCTTTACCCGCATTCAGGGAAGTTTGTACACCTGCCAAAACGAAGATATGGCTA
ACCTGTTTTCAGCCATCAACGAGCTAAAAGCTCTGCCTTGGTTTCCGTCTTCTGTCCGCGATATTCGGGCGTTCCGCATT
GAGCAGTGGTCTGATTTCACAAGTCTTGTGAAGTCTTAA
ATGTACGCGATTTCTTTTGATTTGGTGGTTGCCGATACCGCTCAAAACCATCCGAAAGGCATTTCCCAAGCCTACGCGGA
TATTGGATACACCCTGCGGAAATTCGGCTTTACCCGCATTCAGGGAAGTTTGTACACCTGCCAAAACGAAGATATGGCTA
ACCTGTTTTCAGCCATCAACGAGCTAAAAGCTCTGCCTTGGTTTCCGTCTTCTGTCCGCGATATTCGGGCGTTCCGCATT
GAGCAGTGGTCTGATTTCACAAGTCTTGTGAAGTCTTAA
Antitoxin
Download Length: 60 bp
>AT201496 NZ_CP074118:7557-7616 [Klebsiella pneumoniae subsp. pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|