Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2552113..2552741 | Replicon | chromosome |
Accession | NZ_CP074073 | ||
Organism | Idiomarina loihiensis strain SN11 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | KF946_RS12220 | Protein ID | WP_153850219.1 |
Coordinates | 2552448..2552741 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | KF946_RS12215 | Protein ID | WP_153850220.1 |
Coordinates | 2552113..2552436 (-) | Length | 108 a.a. |
Genomic Context
Location: 2549889..2550950 (1062 bp)
Type: Others
Protein ID: WP_228758016.1
Type: Others
Protein ID: WP_228758016.1
Location: 2551044..2551337 (294 bp)
Type: Others
Protein ID: WP_034822886.1
Type: Others
Protein ID: WP_034822886.1
Location: 2552944..2554224 (1281 bp)
Type: Others
Protein ID: WP_153850218.1
Type: Others
Protein ID: WP_153850218.1
Location: 2554227..2554934 (708 bp)
Type: Others
Protein ID: WP_153850217.1
Type: Others
Protein ID: WP_153850217.1
Location: 2555639..2555911 (273 bp)
Type: Others
Protein ID: WP_114982302.1
Type: Others
Protein ID: WP_114982302.1
Location: 2555898..2556239 (342 bp)
Type: Others
Protein ID: WP_153850215.1
Type: Others
Protein ID: WP_153850215.1
Location: 2557066..2557722 (657 bp)
Type: Others
Protein ID: WP_110013507.1
Type: Others
Protein ID: WP_110013507.1
Location: 2547469..2549028 (1560 bp)
Type: Others
Protein ID: WP_153850223.1
Type: Others
Protein ID: WP_153850223.1
Location: 2549136..2549645 (510 bp)
Type: Others
Protein ID: WP_153850222.1
Type: Others
Protein ID: WP_153850222.1
Location: 2551339..2551986 (648 bp)
Type: Others
Protein ID: WP_153850221.1
Type: Others
Protein ID: WP_153850221.1
Location: 2552113..2552436 (324 bp)
Type: Antitoxin
Protein ID: WP_153850220.1
Type: Antitoxin
Protein ID: WP_153850220.1
Location: 2552448..2552741 (294 bp)
Type: Toxin
Protein ID: WP_153850219.1
Type: Toxin
Protein ID: WP_153850219.1
Location: 2554931..2555536 (606 bp)
Type: Others
Protein ID: WP_153850216.1
Type: Others
Protein ID: WP_153850216.1
Location: 2556263..2556712 (450 bp)
Type: Others
Protein ID: WP_153850214.1
Type: Others
Protein ID: WP_153850214.1
Location: 2556709..2556939 (231 bp)
Type: Others
Protein ID: WP_153850213.1
Type: Others
Protein ID: WP_153850213.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KF946_RS12190 (KF946_12175) | 2547469..2549028 | - | 1560 | WP_153850223.1 | DNA (cytosine-5-)-methyltransferase | - |
KF946_RS12195 (KF946_12180) | 2549136..2549645 | - | 510 | WP_153850222.1 | very short patch repair endonuclease | - |
KF946_RS12200 (KF946_12185) | 2549889..2550950 | + | 1062 | WP_228758016.1 | alpha/beta hydrolase-fold protein | - |
KF946_RS12205 (KF946_12190) | 2551044..2551337 | + | 294 | WP_034822886.1 | type I toxin-antitoxin system antitoxin YafN | - |
KF946_RS12210 (KF946_12195) | 2551339..2551986 | - | 648 | WP_153850221.1 | hypothetical protein | - |
KF946_RS12215 (KF946_12200) | 2552113..2552436 | - | 324 | WP_153850220.1 | HigA family addiction module antitoxin | Antitoxin |
KF946_RS12220 (KF946_12205) | 2552448..2552741 | - | 294 | WP_153850219.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
KF946_RS12225 (KF946_12210) | 2552944..2554224 | + | 1281 | WP_153850218.1 | anti-phage deoxyguanosine triphosphatase | - |
KF946_RS12230 (KF946_12215) | 2554227..2554934 | + | 708 | WP_153850217.1 | ZIP family metal transporter | - |
KF946_RS12235 (KF946_12220) | 2554931..2555536 | - | 606 | WP_153850216.1 | hypothetical protein | - |
KF946_RS12240 (KF946_12225) | 2555639..2555911 | + | 273 | WP_114982302.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
KF946_RS12245 (KF946_12230) | 2555898..2556239 | + | 342 | WP_153850215.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
KF946_RS12250 (KF946_12235) | 2556263..2556712 | - | 450 | WP_153850214.1 | type II toxin-antitoxin system VapC family toxin | - |
KF946_RS12255 (KF946_12240) | 2556709..2556939 | - | 231 | WP_153850213.1 | type II toxin-antitoxin system VapB family antitoxin | - |
KF946_RS12260 (KF946_12245) | 2557066..2557722 | + | 657 | WP_110013507.1 | epoxyqueuosine reductase QueH | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11520.22 Da Isoelectric Point: 7.8732
>T201333 WP_153850219.1 NZ_CP074073:c2552741-2552448 [Idiomarina loihiensis]
MAVKFRDDWLERFYEDDISHKKIPKIIKGALFRKLEILDAATQESDLRVPLGNRFEYLKGKLSGCCSIRVNRQYRLIFHW
EDGIAQDTYLDPHVYQS
MAVKFRDDWLERFYEDDISHKKIPKIIKGALFRKLEILDAATQESDLRVPLGNRFEYLKGKLSGCCSIRVNRQYRLIFHW
EDGIAQDTYLDPHVYQS
Download Length: 294 bp
>T201333 NZ_CP098338:2114974-2115076 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 108 a.a. Molecular weight: 12351.37 Da Isoelectric Point: 10.2550
>AT201333 WP_153850220.1 NZ_CP074073:c2552436-2552113 [Idiomarina loihiensis]
MRDTKRRPVSVGQMLITEFLEPMNIEIKELADAMRVHRNTLSRIVHDKGALTAPMAIKLAAALGNTPEFWLNIKHAVEIW
DVRHRAYEQEAENVKRLKPHAKPYQQA
MRDTKRRPVSVGQMLITEFLEPMNIEIKELADAMRVHRNTLSRIVHDKGALTAPMAIKLAAALGNTPEFWLNIKHAVEIW
DVRHRAYEQEAENVKRLKPHAKPYQQA
Download Length: 324 bp
>AT201333 NZ_CP098338:c2115083-2114938 [Klebsiella pneumoniae]
TAAAGATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAG
TTGGCATTAATGCAGGCTAAGTCGCCTTGCACTATAAGAATAGTTTAACGCGTCAGCTTTTCCAGT
TAAAGATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAG
TTGGCATTAATGCAGGCTAAGTCGCCTTGCACTATAAGAATAGTTTAACGCGTCAGCTTTTCCAGT