Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 44792..45056 | Replicon | plasmid pYLPI7c |
Accession | NZ_CP074036 | ||
Organism | Escherichia coli strain PI7 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Z417 |
Locus tag | KFU70_RS25195 | Protein ID | WP_001387489.1 |
Coordinates | 44904..45056 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 44792..44854 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KFU70_RS25180 (40894) | 40894..41964 | - | 1071 | WP_000151588.1 | IncI1-type conjugal transfer protein TrbB | - |
KFU70_RS25185 (41983) | 41983..43191 | - | 1209 | WP_000121263.1 | IncI1-type conjugal transfer protein TrbA | - |
KFU70_RS25190 (43498) | 43498..44583 | - | 1086 | WP_000080543.1 | protein finQ | - |
- (44792) | 44792..44854 | - | 63 | NuclAT_0 | - | Antitoxin |
- (44792) | 44792..44854 | - | 63 | NuclAT_0 | - | Antitoxin |
- (44792) | 44792..44854 | - | 63 | NuclAT_0 | - | Antitoxin |
- (44792) | 44792..44854 | - | 63 | NuclAT_0 | - | Antitoxin |
KFU70_RS25195 (44904) | 44904..45056 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
KFU70_RS25200 (45128) | 45128..45379 | - | 252 | WP_001291964.1 | hypothetical protein | - |
KFU70_RS25205 (45679) | 45679..45975 | + | 297 | WP_001275298.1 | DinQ-like type I toxin DqlB | - |
KFU70_RS25210 (46040) | 46040..46216 | - | 177 | WP_001054898.1 | hypothetical protein | - |
KFU70_RS25215 (46399) | 46399..46608 | - | 210 | WP_001140543.1 | hemolysin expression modulator Hha | - |
KFU70_RS25220 (46706) | 46706..47320 | - | 615 | WP_000578648.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
KFU70_RS25225 (47396) | 47396..49564 | - | 2169 | WP_000698360.1 | IncI1-type conjugal transfer membrane protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | qnrS1 / blaCTX-M-15 | - | 1..88772 | 88772 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T201255 WP_001387489.1 NZ_CP074036:44904-45056 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T201255 NZ_CP098247:c1039054-1038845 [Oxalobacter aliiformigenes]
ATGAACAAGCTTGCCCTGGTTCCGGCCAATCAATTCAAACGCGATGCCAGAAAACAGTTCCAGATGCTGCTTACGGCAGA
ACGGGCAGAGGTTCTCCATTGTCTGATTAACGACAAGGAACTGCCTGAAAAATACTGTGATCACTCCCTGACCGGTGATT
TCAGGGATTATCGGGAATGTCATATCAGGCCAGACCTGTTGTTGGTATAG
ATGAACAAGCTTGCCCTGGTTCCGGCCAATCAATTCAAACGCGATGCCAGAAAACAGTTCCAGATGCTGCTTACGGCAGA
ACGGGCAGAGGTTCTCCATTGTCTGATTAACGACAAGGAACTGCCTGAAAAATACTGTGATCACTCCCTGACCGGTGATT
TCAGGGATTATCGGGAATGTCATATCAGGCCAGACCTGTTGTTGGTATAG
Antitoxin
Download Length: 63 bp
>AT201255 NZ_CP074036:c44854-44792 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|