Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 65253..65507 Replicon plasmid pYLPK12
Accession NZ_CP074032
Organism Escherichia coli strain PK12

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag KFU67_RS24685 Protein ID WP_001312851.1
Coordinates 65253..65402 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 65446..65507 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KFU67_RS24640 (60805) 60805..61206 - 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -
KFU67_RS24645 (61139) 61139..61396 - 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
KFU67_RS24650 (61489) 61489..62142 - 654 WP_000616807.1 CPBP family intramembrane metalloprotease -
KFU67_RS24655 (62240) 62240..62380 - 141 WP_001333237.1 hypothetical protein -
KFU67_RS24660 (63081) 63081..63938 - 858 WP_000774297.1 incFII family plasmid replication initiator RepA -
KFU67_RS24665 (63931) 63931..64413 - 483 WP_001273588.1 hypothetical protein -
KFU67_RS24670 (64406) 64406..64453 - 48 WP_229471593.1 hypothetical protein -
KFU67_RS24675 (64444) 64444..64695 + 252 WP_223195197.1 replication protein RepA -
KFU67_RS24680 (64712) 64712..64969 - 258 WP_000083845.1 replication regulatory protein RepA -
KFU67_RS24685 (65253) 65253..65402 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (65446) 65446..65507 + 62 NuclAT_1 - Antitoxin
- (65446) 65446..65507 + 62 NuclAT_1 - Antitoxin
- (65446) 65446..65507 + 62 NuclAT_1 - Antitoxin
- (65446) 65446..65507 + 62 NuclAT_1 - Antitoxin
KFU67_RS24690 (65763) 65763..65837 - 75 Protein_78 endonuclease -
KFU67_RS24695 (66083) 66083..66295 - 213 WP_001299730.1 ANR family transcriptional regulator -
KFU67_RS24700 (66431) 66431..66991 - 561 WP_000139315.1 fertility inhibition protein FinO -
KFU67_RS24705 (67094) 67094..67954 - 861 WP_000704513.1 alpha/beta hydrolase -
KFU67_RS24710 (68013) 68013..68759 - 747 WP_000205749.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-55 / tet(A) / aph(3')-Ia / catA2 / dfrA14 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / sitABCD iutA / iucD / iucC / iucB / iucA 1..129015 129015


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T201215 WP_001312851.1 NZ_CP074032:c65402-65253 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

>T201215 NZ_CP098233:44592-44741 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCTACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT201215 NZ_CP074032:65446-65507 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References