Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | timP-timR/- |
Location | 4268952..4269236 | Replicon | chromosome |
Accession | NZ_CP074028 | ||
Organism | Escherichia coli strain PK13 |
Toxin (Protein)
Gene name | timP | Uniprot ID | - |
Locus tag | KFU76_RS20665 | Protein ID | WP_001385884.1 |
Coordinates | 4268952..4269077 (-) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | timR | ||
Locus tag | - | ||
Coordinates | 4269173..4269236 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KFU76_RS20640 | 4264142..4265992 | + | 1851 | WP_001196613.1 | Fe-S protein assembly chaperone HscA | - |
KFU76_RS20645 | 4265994..4266329 | + | 336 | WP_001124469.1 | ISC system 2Fe-2S type ferredoxin | - |
KFU76_RS20650 | 4266341..4266541 | + | 201 | WP_000523616.1 | Fe-S cluster assembly protein IscX | - |
KFU76_RS20655 | 4266719..4268002 | + | 1284 | WP_000133582.1 | aminopeptidase PepB | - |
KFU76_RS20660 | 4268144..4268920 | + | 777 | WP_001297328.1 | enhanced serine sensitivity protein SseB | - |
KFU76_RS20665 | 4268952..4269077 | - | 126 | WP_001385884.1 | small toxic inner membrane protein TimP | Toxin |
KFU76_RS20670 | 4269088..4269210 | + | 123 | WP_256385323.1 | hypothetical protein | - |
- | 4269173..4269236 | + | 64 | - | - | Antitoxin |
KFU76_RS20675 | 4269253..4270098 | - | 846 | WP_000108626.1 | 3-mercaptopyruvate sulfurtransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4496.28 Da Isoelectric Point: 9.6571
>T201183 WP_001385884.1 NZ_CP074028:c4269077-4268952 [Escherichia coli]
MKIRCFCIVLIVSGALFSQVNNNRSLSGDNLLVVNNLQSSK
MKIRCFCIVLIVSGALFSQVNNNRSLSGDNLLVVNNLQSSK
Download Length: 126 bp
>T201183 NZ_CP098229:2830070-2830177 [Escherichia coli]
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 64 bp
>AT201183 NZ_CP074028:4269173-4269236 [Escherichia coli]
CAACCTGCTGGAAAGGCCGCGAACCAGACCAGCAATAAAAAACCGCCAAATTCGGCGGTTTTTT
CAACCTGCTGGAAAGGCCGCGAACCAGACCAGCAATAAAAAACCGCCAAATTCGGCGGTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|