Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 41742..42006 | Replicon | plasmid pYLPM22b |
| Accession | NZ_CP074021 | ||
| Organism | Escherichia coli strain PM22 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | KFU87_RS23975 | Protein ID | WP_001331364.1 |
| Coordinates | 41854..42006 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 41742..41799 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KFU87_RS23960 (37784) | 37784..38854 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| KFU87_RS23965 (38873) | 38873..40081 | - | 1209 | WP_001383960.1 | IncI1-type conjugal transfer protein TrbA | - |
| KFU87_RS23970 (40299) | 40299..41252 | - | 954 | WP_021513958.1 | hypothetical protein | - |
| - (41446) | 41446..41501 | - | 56 | NuclAT_1 | - | - |
| - (41446) | 41446..41501 | - | 56 | NuclAT_1 | - | - |
| - (41446) | 41446..41501 | - | 56 | NuclAT_1 | - | - |
| - (41446) | 41446..41501 | - | 56 | NuclAT_1 | - | - |
| - (41742) | 41742..41799 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (41742) | 41742..41799 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (41742) | 41742..41799 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (41742) | 41742..41799 | - | 58 | NuclAT_0 | - | Antitoxin |
| KFU87_RS23975 (41854) | 41854..42006 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| KFU87_RS23980 (42078) | 42078..42329 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| KFU87_RS23985 (42691) | 42691..42923 | + | 233 | Protein_50 | hypothetical protein | - |
| KFU87_RS23990 (42988) | 42988..43164 | - | 177 | WP_001054898.1 | hypothetical protein | - |
| KFU87_RS23995 (43556) | 43556..43765 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| KFU87_RS24000 (43837) | 43837..44487 | - | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| KFU87_RS24005 (44561) | 44561..46729 | - | 2169 | WP_000698357.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..88082 | 88082 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T201134 WP_001331364.1 NZ_CP074021:41854-42006 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T201134 NZ_CP098223:c2141121-2141014 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 58 bp
>AT201134 NZ_CP074021:c41799-41742 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|