Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 56601..56855 | Replicon | plasmid pYLPM22a |
Accession | NZ_CP074020 | ||
Organism | Escherichia coli strain PM22 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | KFU87_RS23345 | Protein ID | WP_001312851.1 |
Coordinates | 56601..56750 (-) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 56794..56855 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KFU87_RS23300 (52153) | 52153..52554 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
KFU87_RS23305 (52487) | 52487..52744 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
KFU87_RS23310 (52837) | 52837..53490 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
KFU87_RS23315 (53588) | 53588..53728 | - | 141 | WP_001333237.1 | hypothetical protein | - |
KFU87_RS23320 (54429) | 54429..55286 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
KFU87_RS23325 (55279) | 55279..55761 | - | 483 | WP_001273588.1 | hypothetical protein | - |
KFU87_RS23330 (55754) | 55754..55801 | - | 48 | WP_229471593.1 | hypothetical protein | - |
KFU87_RS23335 (55792) | 55792..56043 | + | 252 | WP_223195197.1 | replication protein RepA | - |
KFU87_RS23340 (56060) | 56060..56317 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
KFU87_RS23345 (56601) | 56601..56750 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
- (56794) | 56794..56855 | + | 62 | NuclAT_1 | - | Antitoxin |
- (56794) | 56794..56855 | + | 62 | NuclAT_1 | - | Antitoxin |
- (56794) | 56794..56855 | + | 62 | NuclAT_1 | - | Antitoxin |
- (56794) | 56794..56855 | + | 62 | NuclAT_1 | - | Antitoxin |
KFU87_RS23350 (57111) | 57111..57185 | - | 75 | Protein_69 | endonuclease | - |
KFU87_RS23355 (57431) | 57431..57643 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
KFU87_RS23360 (57779) | 57779..58339 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
KFU87_RS23365 (58442) | 58442..59302 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
KFU87_RS23370 (59361) | 59361..60107 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-55 / tet(A) / aph(3')-Ia / ant(3'')-Ia / lnu(F) / aac(3)-IIa / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..120320 | 120320 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T201126 WP_001312851.1 NZ_CP074020:c56750-56601 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T201126 NZ_CP098221:c12470-12216 [Escherichia coli]
ATGAGAAAAAACAAAGGGCGATTGACTTATTATCTTGAAGTGATTGATAAAAAATACCATTTTGTAAAAAAAATAAGCAG
TTATTCAAAGGAGTTCACTGACGGAAAAACAAAAAGAACAAAGAGAACGTTAAGTGAGCTGGTTTTTAATGAAAGTGAGG
TCGAGGCAATAGACTTTACAAAAAATGGTTTAAGACCTGTTGATAAGAATATTCTCTTAACTATGGTGAAAGAATATAAG
GAGAGTGATGCATGA
ATGAGAAAAAACAAAGGGCGATTGACTTATTATCTTGAAGTGATTGATAAAAAATACCATTTTGTAAAAAAAATAAGCAG
TTATTCAAAGGAGTTCACTGACGGAAAAACAAAAAGAACAAAGAGAACGTTAAGTGAGCTGGTTTTTAATGAAAGTGAGG
TCGAGGCAATAGACTTTACAAAAAATGGTTTAAGACCTGTTGATAAGAATATTCTCTTAACTATGGTGAAAGAATATAAG
GAGAGTGATGCATGA
Antitoxin
Download Length: 62 bp
>AT201126 NZ_CP074020:56794-56855 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|