Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2752804..2753024 Replicon chromosome
Accession NZ_CP073984
Organism Escherichia coli strain MB15

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag KFU92_RS13570 Protein ID WP_000170965.1
Coordinates 2752917..2753024 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2752804..2752870 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KFU92_RS13545 2748083..2749477 - 1395 WP_000086201.1 inverse autotransporter invasin YchO -
KFU92_RS13550 2749662..2750015 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
KFU92_RS13555 2750059..2750754 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
KFU92_RS13560 2750912..2751142 - 231 WP_001146442.1 putative cation transport regulator ChaB -
KFU92_RS13565 2751412..2752512 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2752804..2752870 - 67 - - Antitoxin
KFU92_RS13570 2752917..2753024 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2753337..2753400 - 64 NuclAT_34 - -
- 2753337..2753400 - 64 NuclAT_34 - -
- 2753337..2753400 - 64 NuclAT_34 - -
- 2753337..2753400 - 64 NuclAT_34 - -
- 2753337..2753400 - 64 NuclAT_36 - -
- 2753337..2753400 - 64 NuclAT_36 - -
- 2753337..2753400 - 64 NuclAT_36 - -
- 2753337..2753400 - 64 NuclAT_36 - -
- 2753337..2753400 - 64 NuclAT_38 - -
- 2753337..2753400 - 64 NuclAT_38 - -
- 2753337..2753400 - 64 NuclAT_38 - -
- 2753337..2753400 - 64 NuclAT_38 - -
- 2753337..2753400 - 64 NuclAT_40 - -
- 2753337..2753400 - 64 NuclAT_40 - -
- 2753337..2753400 - 64 NuclAT_40 - -
- 2753337..2753400 - 64 NuclAT_40 - -
- 2753337..2753400 - 64 NuclAT_42 - -
- 2753337..2753400 - 64 NuclAT_42 - -
- 2753337..2753400 - 64 NuclAT_42 - -
- 2753337..2753400 - 64 NuclAT_42 - -
- 2753337..2753400 - 64 NuclAT_44 - -
- 2753337..2753400 - 64 NuclAT_44 - -
- 2753337..2753400 - 64 NuclAT_44 - -
- 2753337..2753400 - 64 NuclAT_44 - -
- 2753338..2753400 - 63 NuclAT_46 - -
- 2753338..2753400 - 63 NuclAT_46 - -
- 2753338..2753400 - 63 NuclAT_46 - -
- 2753338..2753400 - 63 NuclAT_46 - -
- 2753338..2753400 - 63 NuclAT_49 - -
- 2753338..2753400 - 63 NuclAT_49 - -
- 2753338..2753400 - 63 NuclAT_49 - -
- 2753338..2753400 - 63 NuclAT_49 - -
- 2753339..2753400 - 62 NuclAT_16 - -
- 2753339..2753400 - 62 NuclAT_16 - -
- 2753339..2753400 - 62 NuclAT_16 - -
- 2753339..2753400 - 62 NuclAT_16 - -
- 2753339..2753400 - 62 NuclAT_19 - -
- 2753339..2753400 - 62 NuclAT_19 - -
- 2753339..2753400 - 62 NuclAT_19 - -
- 2753339..2753400 - 62 NuclAT_19 - -
- 2753339..2753400 - 62 NuclAT_22 - -
- 2753339..2753400 - 62 NuclAT_22 - -
- 2753339..2753400 - 62 NuclAT_22 - -
- 2753339..2753400 - 62 NuclAT_22 - -
- 2753339..2753400 - 62 NuclAT_25 - -
- 2753339..2753400 - 62 NuclAT_25 - -
- 2753339..2753400 - 62 NuclAT_25 - -
- 2753339..2753400 - 62 NuclAT_25 - -
- 2753339..2753400 - 62 NuclAT_28 - -
- 2753339..2753400 - 62 NuclAT_28 - -
- 2753339..2753400 - 62 NuclAT_28 - -
- 2753339..2753400 - 62 NuclAT_28 - -
- 2753339..2753400 - 62 NuclAT_31 - -
- 2753339..2753400 - 62 NuclAT_31 - -
- 2753339..2753400 - 62 NuclAT_31 - -
- 2753339..2753400 - 62 NuclAT_31 - -
KFU92_RS13575 2753453..2753560 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2753874..2753940 - 67 NuclAT_45 - -
- 2753874..2753940 - 67 NuclAT_45 - -
- 2753874..2753940 - 67 NuclAT_45 - -
- 2753874..2753940 - 67 NuclAT_45 - -
- 2753874..2753940 - 67 NuclAT_48 - -
- 2753874..2753940 - 67 NuclAT_48 - -
- 2753874..2753940 - 67 NuclAT_48 - -
- 2753874..2753940 - 67 NuclAT_48 - -
- 2753875..2753938 - 64 NuclAT_17 - -
- 2753875..2753938 - 64 NuclAT_17 - -
- 2753875..2753938 - 64 NuclAT_17 - -
- 2753875..2753938 - 64 NuclAT_17 - -
- 2753875..2753938 - 64 NuclAT_20 - -
- 2753875..2753938 - 64 NuclAT_20 - -
- 2753875..2753938 - 64 NuclAT_20 - -
- 2753875..2753938 - 64 NuclAT_20 - -
- 2753875..2753938 - 64 NuclAT_23 - -
- 2753875..2753938 - 64 NuclAT_23 - -
- 2753875..2753938 - 64 NuclAT_23 - -
- 2753875..2753938 - 64 NuclAT_23 - -
- 2753875..2753938 - 64 NuclAT_26 - -
- 2753875..2753938 - 64 NuclAT_26 - -
- 2753875..2753938 - 64 NuclAT_26 - -
- 2753875..2753938 - 64 NuclAT_26 - -
- 2753875..2753938 - 64 NuclAT_29 - -
- 2753875..2753938 - 64 NuclAT_29 - -
- 2753875..2753938 - 64 NuclAT_29 - -
- 2753875..2753938 - 64 NuclAT_29 - -
- 2753875..2753938 - 64 NuclAT_32 - -
- 2753875..2753938 - 64 NuclAT_32 - -
- 2753875..2753938 - 64 NuclAT_32 - -
- 2753875..2753938 - 64 NuclAT_32 - -
KFU92_RS13580 2753988..2754095 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
KFU92_RS13585 2754244..2755098 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
KFU92_RS13590 2755134..2755943 - 810 WP_001257044.1 invasion regulator SirB1 -
KFU92_RS13595 2755947..2756339 - 393 WP_000200378.1 invasion regulator SirB2 -
KFU92_RS13600 2756336..2757169 - 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T200926 WP_000170965.1 NZ_CP073984:2752917-2753024 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T200926 NZ_CP098197:c3921521-3921123 [Escherichia coli]
ATGCGGGTATTCAAAACAAAACTTATTCGCCTGCAACTTACAGCAGAGGAACTTGATGCGTTAACGGCGGATTTTATTTC
CTATAAGCGTGACGGTGTTTTGCCAGATATATTTGGTCGCGATGCACTCTACGACGACTCGTTTACCTGGCCATTAATCA
AATTTGAGCGAGTTGCTCATATTCATCTGGCAAATGTGAATAATCCATTTCCGCCACAGTTGCGCCAATTCAGCAGAACG
AATGACGAAGCGCATTTGGTATATTGTCAGGGTGCGTTTGATGAGCAAGCATGGTTGCTCATTGCCATTCTGAAGCCTGA
ACCTCATAAACTGGCTCGAGATAACAACCAAATGCATAAAATTGGAAAAATGGCAGAAGCGTTTCGCATGCGTTTTTGA

Antitoxin


Download         Length: 67 bp

>AT200926 NZ_CP073984:c2752870-2752804 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References