Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 73122..73376 | Replicon | plasmid pYLMB98a |
| Accession | NZ_CP073927 | ||
| Organism | Escherichia coli strain MB98 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | KFU77_RS23925 | Protein ID | WP_001312851.1 |
| Coordinates | 73122..73271 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 73315..73376 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KFU77_RS23895 (69145) | 69145..69546 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| KFU77_RS23900 (69479) | 69479..69736 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| KFU77_RS23905 (69829) | 69829..70482 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| KFU77_RS23910 (71421) | 71421..72278 | - | 858 | WP_013362810.1 | incFII family plasmid replication initiator RepA | - |
| KFU77_RS23915 (72271) | 72271..72345 | - | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| KFU77_RS23920 (72581) | 72581..72838 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| KFU77_RS23925 (73122) | 73122..73271 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (73315) | 73315..73376 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (73315) | 73315..73376 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (73315) | 73315..73376 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (73315) | 73315..73376 | + | 62 | NuclAT_0 | - | Antitoxin |
| KFU77_RS23930 (73515) | 73515..73697 | - | 183 | WP_000968309.1 | hypothetical protein | - |
| KFU77_RS23935 (73798) | 73798..74414 | + | 617 | Protein_89 | IS1-like element IS1A family transposase | - |
| KFU77_RS23940 (74452) | 74452..76023 | - | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| KFU77_RS23945 (76043) | 76043..76390 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| KFU77_RS23950 (76390) | 76390..77067 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| KFU77_RS23955 (77122) | 77122..77211 | + | 90 | Protein_93 | IS1 family transposase | - |
| KFU77_RS23960 (77512) | 77512..77724 | - | 213 | WP_005012601.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(B) / mph(A) / blaCTX-M-15 / aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..118380 | 118380 | |
| - | inside | IScluster/Tn | tet(B) / mph(A) / blaCTX-M-15 / aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr | - | 35636..77037 | 41401 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T200587 WP_001312851.1 NZ_CP073927:c73271-73122 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T200587 NZ_CP098030:c1112048-1111845 [Serratia ureilytica]
ATGACTAAAACCGACTATCTGATGCGTTTACGTAAATGCACCACGATTGATACTCTCGAACGTGTTATTGAAAAAAATAA
GTACGAGCTTTCCGATGATGAACTGGAGCTGTTTTACTCAGCCGCCGATCATCGTTTGGCGGAGCTGACCATGAACAAGC
TGTATGACAAAATCCCCACCTCCGTTTGGAAATATGTCAGATAA
ATGACTAAAACCGACTATCTGATGCGTTTACGTAAATGCACCACGATTGATACTCTCGAACGTGTTATTGAAAAAAATAA
GTACGAGCTTTCCGATGATGAACTGGAGCTGTTTTACTCAGCCGCCGATCATCGTTTGGCGGAGCTGACCATGAACAAGC
TGTATGACAAAATCCCCACCTCCGTTTGGAAATATGTCAGATAA
Antitoxin
Download Length: 62 bp
>AT200587 NZ_CP073927:73315-73376 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|