Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-doc
Location 819694..820319 Replicon chromosome
Accession NZ_CP073895
Organism Staphylococcus epidermidis strain V1937538

Toxin (Protein)


Gene name doc Uniprot ID Q5HMS9
Locus tag KFV38_RS04155 Protein ID WP_002504557.1
Coordinates 819924..820319 (+) Length 132 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A4Y7VKS9
Locus tag KFV38_RS04150 Protein ID WP_002504558.1
Coordinates 819694..819924 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KFV38_RS04085 (KFV38_04085) 814763..815245 + 483 WP_002504570.1 hypothetical protein -
KFV38_RS04090 (KFV38_04090) 815261..815440 + 180 WP_002504569.1 hypothetical protein -
KFV38_RS04095 (KFV38_04095) 815425..815610 + 186 WP_001187008.1 hypothetical protein -
KFV38_RS04100 (KFV38_04100) 815626..815910 + 285 WP_002504568.1 hypothetical protein -
KFV38_RS04105 (KFV38_04105) 815907..816062 + 156 WP_002504567.1 transcriptional activator RinB -
KFV38_RS04110 (KFV38_04110) 816088..816360 + 273 WP_002504566.1 hypothetical protein -
KFV38_RS04115 (KFV38_04115) 816376..816918 + 543 WP_002504565.1 hypothetical protein -
KFV38_RS04120 (KFV38_04120) 816911..817087 + 177 WP_002504564.1 hypothetical protein -
KFV38_RS04125 (KFV38_04125) 817107..817328 + 222 WP_002504563.1 hypothetical protein -
KFV38_RS04130 (KFV38_04130) 817328..818053 + 726 WP_010959229.1 metallophosphoesterase -
KFV38_RS04135 (KFV38_04135) 818046..818363 + 318 WP_002504561.1 hypothetical protein -
KFV38_RS04140 (KFV38_04140) 818363..819013 + 651 WP_002504560.1 hypothetical protein -
KFV38_RS04145 (KFV38_04145) 819013..819531 + 519 WP_002504559.1 metallophosphoesterase -
KFV38_RS04150 (KFV38_04150) 819694..819924 + 231 WP_002504558.1 addiction module antitoxin Antitoxin
KFV38_RS04155 (KFV38_04155) 819924..820319 + 396 WP_002504557.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
KFV38_RS04160 (KFV38_04160) 820682..820813 + 132 WP_257243913.1 hypothetical protein -
KFV38_RS04165 (KFV38_04165) 820797..821066 + 270 WP_000755772.1 hypothetical protein -
KFV38_RS04170 (KFV38_04170) 821123..821617 + 495 WP_010959224.1 hypothetical protein -
KFV38_RS04175 (KFV38_04175) 821621..822421 + 801 WP_000686449.1 metallophosphoesterase -
KFV38_RS04180 (KFV38_04180) 822530..823252 + 723 WP_002504538.1 hypothetical protein -
KFV38_RS04185 (KFV38_04185) 823358..823999 + 642 WP_002504537.1 hypothetical protein -
KFV38_RS13440 824030..824164 - 135 WP_002504536.1 hypothetical protein -
KFV38_RS04190 (KFV38_04190) 824247..824651 - 405 WP_002504535.1 YolD-like family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage aac(6')-aph(2'') - 718947..852997 134050


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-129)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 14992.31 Da        Isoelectric Point: 9.4885

>T200479 WP_002504557.1 NZ_CP073895:819924-820319 [Staphylococcus epidermidis]
MQSTKYLTEKQVIAINVKAIQDFSPKEQVGVKVPEVLNATIEGVKQSFGGVELYETIERKAAFIYRNIAQKHAFHNANKR
TAFTSMVIFLKLNSINFECTQDEAVQFTLRVVNDKNLTLEGIETWIKRHCK

Download         Length: 396 bp

>T200479 NZ_CP097882:2598860-2598967 [Escherichia coli str. K-12 substr. MG1655]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8648.89 Da        Isoelectric Point: 5.1231

>AT200479 WP_002504558.1 NZ_CP073895:819694-819924 [Staphylococcus epidermidis]
MITTRKLRKAGNSSVVSVPTEVIAALGISNGDNLKFNVKDNKVTIEKEVREDEEFFKLLDETFTEYNQALKRMVDL

Download         Length: 231 bp

>AT200479 NZ_CP097882:c2598810-2598747 [Escherichia coli str. K-12 substr. MG1655]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4Y7VKP2

Antitoxin

Source ID Structure
AlphaFold DB A0A4Y7VKS9

References