Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-doc |
Location | 819694..820319 | Replicon | chromosome |
Accession | NZ_CP073895 | ||
Organism | Staphylococcus epidermidis strain V1937538 |
Toxin (Protein)
Gene name | doc | Uniprot ID | Q5HMS9 |
Locus tag | KFV38_RS04155 | Protein ID | WP_002504557.1 |
Coordinates | 819924..820319 (+) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | A0A4Y7VKS9 |
Locus tag | KFV38_RS04150 | Protein ID | WP_002504558.1 |
Coordinates | 819694..819924 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KFV38_RS04085 (KFV38_04085) | 814763..815245 | + | 483 | WP_002504570.1 | hypothetical protein | - |
KFV38_RS04090 (KFV38_04090) | 815261..815440 | + | 180 | WP_002504569.1 | hypothetical protein | - |
KFV38_RS04095 (KFV38_04095) | 815425..815610 | + | 186 | WP_001187008.1 | hypothetical protein | - |
KFV38_RS04100 (KFV38_04100) | 815626..815910 | + | 285 | WP_002504568.1 | hypothetical protein | - |
KFV38_RS04105 (KFV38_04105) | 815907..816062 | + | 156 | WP_002504567.1 | transcriptional activator RinB | - |
KFV38_RS04110 (KFV38_04110) | 816088..816360 | + | 273 | WP_002504566.1 | hypothetical protein | - |
KFV38_RS04115 (KFV38_04115) | 816376..816918 | + | 543 | WP_002504565.1 | hypothetical protein | - |
KFV38_RS04120 (KFV38_04120) | 816911..817087 | + | 177 | WP_002504564.1 | hypothetical protein | - |
KFV38_RS04125 (KFV38_04125) | 817107..817328 | + | 222 | WP_002504563.1 | hypothetical protein | - |
KFV38_RS04130 (KFV38_04130) | 817328..818053 | + | 726 | WP_010959229.1 | metallophosphoesterase | - |
KFV38_RS04135 (KFV38_04135) | 818046..818363 | + | 318 | WP_002504561.1 | hypothetical protein | - |
KFV38_RS04140 (KFV38_04140) | 818363..819013 | + | 651 | WP_002504560.1 | hypothetical protein | - |
KFV38_RS04145 (KFV38_04145) | 819013..819531 | + | 519 | WP_002504559.1 | metallophosphoesterase | - |
KFV38_RS04150 (KFV38_04150) | 819694..819924 | + | 231 | WP_002504558.1 | addiction module antitoxin | Antitoxin |
KFV38_RS04155 (KFV38_04155) | 819924..820319 | + | 396 | WP_002504557.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
KFV38_RS04160 (KFV38_04160) | 820682..820813 | + | 132 | WP_257243913.1 | hypothetical protein | - |
KFV38_RS04165 (KFV38_04165) | 820797..821066 | + | 270 | WP_000755772.1 | hypothetical protein | - |
KFV38_RS04170 (KFV38_04170) | 821123..821617 | + | 495 | WP_010959224.1 | hypothetical protein | - |
KFV38_RS04175 (KFV38_04175) | 821621..822421 | + | 801 | WP_000686449.1 | metallophosphoesterase | - |
KFV38_RS04180 (KFV38_04180) | 822530..823252 | + | 723 | WP_002504538.1 | hypothetical protein | - |
KFV38_RS04185 (KFV38_04185) | 823358..823999 | + | 642 | WP_002504537.1 | hypothetical protein | - |
KFV38_RS13440 | 824030..824164 | - | 135 | WP_002504536.1 | hypothetical protein | - |
KFV38_RS04190 (KFV38_04190) | 824247..824651 | - | 405 | WP_002504535.1 | YolD-like family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | aac(6')-aph(2'') | - | 718947..852997 | 134050 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14992.31 Da Isoelectric Point: 9.4885
>T200479 WP_002504557.1 NZ_CP073895:819924-820319 [Staphylococcus epidermidis]
MQSTKYLTEKQVIAINVKAIQDFSPKEQVGVKVPEVLNATIEGVKQSFGGVELYETIERKAAFIYRNIAQKHAFHNANKR
TAFTSMVIFLKLNSINFECTQDEAVQFTLRVVNDKNLTLEGIETWIKRHCK
MQSTKYLTEKQVIAINVKAIQDFSPKEQVGVKVPEVLNATIEGVKQSFGGVELYETIERKAAFIYRNIAQKHAFHNANKR
TAFTSMVIFLKLNSINFECTQDEAVQFTLRVVNDKNLTLEGIETWIKRHCK
Download Length: 396 bp
>T200479 NZ_CP097882:2598860-2598967 [Escherichia coli str. K-12 substr. MG1655]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 77 a.a. Molecular weight: 8648.89 Da Isoelectric Point: 5.1231
>AT200479 WP_002504558.1 NZ_CP073895:819694-819924 [Staphylococcus epidermidis]
MITTRKLRKAGNSSVVSVPTEVIAALGISNGDNLKFNVKDNKVTIEKEVREDEEFFKLLDETFTEYNQALKRMVDL
MITTRKLRKAGNSSVVSVPTEVIAALGISNGDNLKFNVKDNKVTIEKEVREDEEFFKLLDETFTEYNQALKRMVDL
Download Length: 231 bp
>AT200479 NZ_CP097882:c2598810-2598747 [Escherichia coli str. K-12 substr. MG1655]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCT
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4Y7VKP2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4Y7VKS9 |