Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-doc |
Location | 822252..822877 | Replicon | chromosome |
Accession | NZ_CP073850 | ||
Organism | Staphylococcus epidermidis strain B1266911 |
Toxin (Protein)
Gene name | doc | Uniprot ID | Q5HMS9 |
Locus tag | KFV33_RS04245 | Protein ID | WP_002504557.1 |
Coordinates | 822482..822877 (+) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | A0A4Y7VKS9 |
Locus tag | KFV33_RS04240 | Protein ID | WP_002504558.1 |
Coordinates | 822252..822482 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KFV33_RS04175 (KFV33_04175) | 817321..817803 | + | 483 | WP_002504570.1 | hypothetical protein | - |
KFV33_RS04180 (KFV33_04180) | 817819..817998 | + | 180 | WP_002504569.1 | hypothetical protein | - |
KFV33_RS04185 (KFV33_04185) | 817983..818168 | + | 186 | WP_001187008.1 | hypothetical protein | - |
KFV33_RS04190 (KFV33_04190) | 818184..818468 | + | 285 | WP_002504568.1 | hypothetical protein | - |
KFV33_RS04195 (KFV33_04195) | 818465..818620 | + | 156 | WP_002504567.1 | transcriptional activator RinB | - |
KFV33_RS04200 (KFV33_04200) | 818646..818918 | + | 273 | WP_002504566.1 | hypothetical protein | - |
KFV33_RS04205 (KFV33_04205) | 818934..819476 | + | 543 | WP_002504565.1 | hypothetical protein | - |
KFV33_RS04210 (KFV33_04210) | 819469..819645 | + | 177 | WP_002504564.1 | hypothetical protein | - |
KFV33_RS04215 (KFV33_04215) | 819665..819886 | + | 222 | WP_002504563.1 | hypothetical protein | - |
KFV33_RS04220 (KFV33_04220) | 819886..820611 | + | 726 | WP_010959229.1 | metallophosphoesterase | - |
KFV33_RS04225 (KFV33_04225) | 820604..820921 | + | 318 | WP_002504561.1 | hypothetical protein | - |
KFV33_RS04230 (KFV33_04230) | 820921..821571 | + | 651 | WP_002504560.1 | hypothetical protein | - |
KFV33_RS04235 (KFV33_04235) | 821571..822089 | + | 519 | WP_002504559.1 | metallophosphoesterase | - |
KFV33_RS04240 (KFV33_04240) | 822252..822482 | + | 231 | WP_002504558.1 | addiction module antitoxin | Antitoxin |
KFV33_RS04245 (KFV33_04245) | 822482..822877 | + | 396 | WP_002504557.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
KFV33_RS04250 (KFV33_04250) | 823240..823371 | + | 132 | WP_257243913.1 | hypothetical protein | - |
KFV33_RS04255 (KFV33_04255) | 823355..823624 | + | 270 | WP_000755772.1 | hypothetical protein | - |
KFV33_RS04260 (KFV33_04260) | 823681..824175 | + | 495 | WP_010959224.1 | hypothetical protein | - |
KFV33_RS04265 (KFV33_04265) | 824179..824979 | + | 801 | WP_000686449.1 | metallophosphoesterase | - |
KFV33_RS04270 (KFV33_04270) | 825088..825810 | + | 723 | WP_002504538.1 | hypothetical protein | - |
KFV33_RS04275 (KFV33_04275) | 825916..826557 | + | 642 | WP_002504537.1 | hypothetical protein | - |
KFV33_RS13340 | 826588..826722 | - | 135 | WP_002504536.1 | hypothetical protein | - |
KFV33_RS04280 (KFV33_04280) | 826805..827209 | - | 405 | WP_002504535.1 | YolD-like family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | aac(6')-aph(2'') / fusB | groEL | 721505..888169 | 166664 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14992.31 Da Isoelectric Point: 9.4885
>T200394 WP_002504557.1 NZ_CP073850:822482-822877 [Staphylococcus epidermidis]
MQSTKYLTEKQVIAINVKAIQDFSPKEQVGVKVPEVLNATIEGVKQSFGGVELYETIERKAAFIYRNIAQKHAFHNANKR
TAFTSMVIFLKLNSINFECTQDEAVQFTLRVVNDKNLTLEGIETWIKRHCK
MQSTKYLTEKQVIAINVKAIQDFSPKEQVGVKVPEVLNATIEGVKQSFGGVELYETIERKAAFIYRNIAQKHAFHNANKR
TAFTSMVIFLKLNSINFECTQDEAVQFTLRVVNDKNLTLEGIETWIKRHCK
Download Length: 396 bp
>T200394 NZ_CP097840:2728499-2728654 [Shigella flexneri]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 77 a.a. Molecular weight: 8648.89 Da Isoelectric Point: 5.1231
>AT200394 WP_002504558.1 NZ_CP073850:822252-822482 [Staphylococcus epidermidis]
MITTRKLRKAGNSSVVSVPTEVIAALGISNGDNLKFNVKDNKVTIEKEVREDEEFFKLLDETFTEYNQALKRMVDL
MITTRKLRKAGNSSVVSVPTEVIAALGISNGDNLKFNVKDNKVTIEKEVREDEEFFKLLDETFTEYNQALKRMVDL
Download Length: 231 bp
>AT200394 NZ_CP097840:c2728487-2728429 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4Y7VKP2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4Y7VKS9 |