Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-doc
Location 1892903..1893528 Replicon chromosome
Accession NZ_CP073830
Organism Staphylococcus epidermidis strain B1220165

Toxin (Protein)


Gene name doc Uniprot ID Q5HMS9
Locus tag KFV27_RS09030 Protein ID WP_002504557.1
Coordinates 1892903..1893298 (-) Length 132 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A4Y7VKS9
Locus tag KFV27_RS09035 Protein ID WP_002504558.1
Coordinates 1893298..1893528 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KFV27_RS08995 (KFV27_09005) 1888571..1888975 + 405 WP_002504535.1 YolD-like family protein -
KFV27_RS13420 1889058..1889192 + 135 WP_002504536.1 hypothetical protein -
KFV27_RS09000 (KFV27_09010) 1889223..1889864 - 642 WP_002504537.1 hypothetical protein -
KFV27_RS09005 (KFV27_09015) 1889970..1890692 - 723 WP_002504538.1 hypothetical protein -
KFV27_RS09010 (KFV27_09020) 1890801..1891601 - 801 WP_000686449.1 metallophosphoesterase -
KFV27_RS09015 (KFV27_09025) 1891605..1892099 - 495 WP_010959224.1 hypothetical protein -
KFV27_RS09020 (KFV27_09030) 1892156..1892425 - 270 WP_000755772.1 hypothetical protein -
KFV27_RS09025 (KFV27_09035) 1892409..1892540 - 132 WP_257243913.1 hypothetical protein -
KFV27_RS09030 (KFV27_09040) 1892903..1893298 - 396 WP_002504557.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
KFV27_RS09035 (KFV27_09045) 1893298..1893528 - 231 WP_002504558.1 addiction module antitoxin Antitoxin
KFV27_RS09040 (KFV27_09050) 1893691..1894209 - 519 WP_002504559.1 metallophosphoesterase -
KFV27_RS09045 (KFV27_09055) 1894209..1894859 - 651 WP_002504560.1 hypothetical protein -
KFV27_RS09050 (KFV27_09060) 1894859..1895176 - 318 WP_002504561.1 hypothetical protein -
KFV27_RS09055 (KFV27_09065) 1895169..1895894 - 726 WP_010959229.1 metallophosphoesterase -
KFV27_RS09060 (KFV27_09070) 1895894..1896115 - 222 WP_002504563.1 hypothetical protein -
KFV27_RS09065 (KFV27_09075) 1896135..1896311 - 177 WP_002504564.1 hypothetical protein -
KFV27_RS09070 (KFV27_09080) 1896304..1896846 - 543 WP_002504565.1 hypothetical protein -
KFV27_RS09075 (KFV27_09085) 1896862..1897134 - 273 WP_002504566.1 hypothetical protein -
KFV27_RS09080 (KFV27_09090) 1897160..1897315 - 156 WP_002504567.1 transcriptional activator RinB -
KFV27_RS09085 (KFV27_09095) 1897312..1897596 - 285 WP_002504568.1 hypothetical protein -
KFV27_RS09090 (KFV27_09100) 1897612..1897797 - 186 WP_001187008.1 hypothetical protein -
KFV27_RS09095 (KFV27_09105) 1897782..1897961 - 180 WP_002504569.1 hypothetical protein -
KFV27_RS09100 (KFV27_09110) 1897977..1898459 - 483 WP_002504570.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage aac(6')-aph(2'') - 1861331..1994275 132944


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-129)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 14992.31 Da        Isoelectric Point: 9.4885

>T200357 WP_002504557.1 NZ_CP073830:c1893298-1892903 [Staphylococcus epidermidis]
MQSTKYLTEKQVIAINVKAIQDFSPKEQVGVKVPEVLNATIEGVKQSFGGVELYETIERKAAFIYRNIAQKHAFHNANKR
TAFTSMVIFLKLNSINFECTQDEAVQFTLRVVNDKNLTLEGIETWIKRHCK

Download         Length: 396 bp

>T200357 NZ_CP097834:3628456-3628563 [Shigella flexneri]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAG

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8648.89 Da        Isoelectric Point: 5.1231

>AT200357 WP_002504558.1 NZ_CP073830:c1893528-1893298 [Staphylococcus epidermidis]
MITTRKLRKAGNSSVVSVPTEVIAALGISNGDNLKFNVKDNKVTIEKEVREDEEFFKLLDETFTEYNQALKRMVDL

Download         Length: 231 bp

>AT200357 NZ_CP097834:c3628407-3628341 [Shigella flexneri]
GTCTAGGTTCAAGATTAGCCCCCGTTATGTTGTCAGGTACATACCTGCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4Y7VKP2

Antitoxin

Source ID Structure
AlphaFold DB A0A4Y7VKS9

References