Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-doc |
Location | 1892429..1893054 | Replicon | chromosome |
Accession | NZ_CP073827 | ||
Organism | Staphylococcus epidermidis strain B1208538 |
Toxin (Protein)
Gene name | doc | Uniprot ID | Q5HMS9 |
Locus tag | KFV36_RS09060 | Protein ID | WP_002504557.1 |
Coordinates | 1892429..1892824 (-) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | A0A4Y7VKS9 |
Locus tag | KFV36_RS09065 | Protein ID | WP_002504558.1 |
Coordinates | 1892824..1893054 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KFV36_RS09025 (KFV36_09035) | 1888097..1888501 | + | 405 | WP_002504535.1 | YolD-like family protein | - |
KFV36_RS13465 | 1888584..1888718 | + | 135 | WP_002504536.1 | hypothetical protein | - |
KFV36_RS09030 (KFV36_09040) | 1888749..1889390 | - | 642 | WP_002504537.1 | hypothetical protein | - |
KFV36_RS09035 (KFV36_09045) | 1889496..1890218 | - | 723 | WP_002504538.1 | hypothetical protein | - |
KFV36_RS09040 (KFV36_09050) | 1890327..1891127 | - | 801 | WP_000686449.1 | metallophosphoesterase | - |
KFV36_RS09045 (KFV36_09055) | 1891131..1891625 | - | 495 | WP_010959224.1 | hypothetical protein | - |
KFV36_RS09050 (KFV36_09060) | 1891682..1891951 | - | 270 | WP_000755772.1 | hypothetical protein | - |
KFV36_RS09055 (KFV36_09065) | 1891935..1892126 | - | 192 | WP_002504556.1 | hypothetical protein | - |
KFV36_RS09060 (KFV36_09070) | 1892429..1892824 | - | 396 | WP_002504557.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
KFV36_RS09065 (KFV36_09075) | 1892824..1893054 | - | 231 | WP_002504558.1 | addiction module antitoxin | Antitoxin |
KFV36_RS09070 (KFV36_09080) | 1893217..1893735 | - | 519 | WP_002504559.1 | metallophosphoesterase | - |
KFV36_RS09075 (KFV36_09085) | 1893735..1894385 | - | 651 | WP_002504560.1 | hypothetical protein | - |
KFV36_RS09080 (KFV36_09090) | 1894385..1894702 | - | 318 | WP_002504561.1 | hypothetical protein | - |
KFV36_RS09085 (KFV36_09095) | 1894695..1895420 | - | 726 | WP_010959229.1 | metallophosphoesterase | - |
KFV36_RS09090 (KFV36_09100) | 1895420..1895641 | - | 222 | WP_002504563.1 | hypothetical protein | - |
KFV36_RS09095 (KFV36_09105) | 1895661..1895837 | - | 177 | WP_002504564.1 | hypothetical protein | - |
KFV36_RS09100 (KFV36_09110) | 1895830..1896372 | - | 543 | WP_002504565.1 | hypothetical protein | - |
KFV36_RS09105 (KFV36_09115) | 1896388..1896660 | - | 273 | WP_002504566.1 | hypothetical protein | - |
KFV36_RS09110 (KFV36_09120) | 1896686..1896841 | - | 156 | WP_002504567.1 | transcriptional activator RinB | - |
KFV36_RS09115 (KFV36_09125) | 1896838..1897122 | - | 285 | WP_002504568.1 | hypothetical protein | - |
KFV36_RS09120 (KFV36_09130) | 1897138..1897323 | - | 186 | WP_001187008.1 | hypothetical protein | - |
KFV36_RS09125 (KFV36_09135) | 1897308..1897487 | - | 180 | WP_002504569.1 | hypothetical protein | - |
KFV36_RS09130 (KFV36_09140) | 1897503..1897985 | - | 483 | WP_002504570.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | aac(6')-aph(2'') | - | 1858067..1993802 | 135735 | ||
inside | Prophage | aac(6')-aph(2'') | - | 1860857..1993802 | 132945 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14992.31 Da Isoelectric Point: 9.4885
>T200352 WP_002504557.1 NZ_CP073827:c1892824-1892429 [Staphylococcus epidermidis]
MQSTKYLTEKQVIAINVKAIQDFSPKEQVGVKVPEVLNATIEGVKQSFGGVELYETIERKAAFIYRNIAQKHAFHNANKR
TAFTSMVIFLKLNSINFECTQDEAVQFTLRVVNDKNLTLEGIETWIKRHCK
MQSTKYLTEKQVIAINVKAIQDFSPKEQVGVKVPEVLNATIEGVKQSFGGVELYETIERKAAFIYRNIAQKHAFHNANKR
TAFTSMVIFLKLNSINFECTQDEAVQFTLRVVNDKNLTLEGIETWIKRHCK
Download Length: 396 bp
>T200352 NZ_CP097834:1472608-1472715 [Shigella flexneri]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTGCCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTGCCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 77 a.a. Molecular weight: 8648.89 Da Isoelectric Point: 5.1231
>AT200352 WP_002504558.1 NZ_CP073827:c1893054-1892824 [Staphylococcus epidermidis]
MITTRKLRKAGNSSVVSVPTEVIAALGISNGDNLKFNVKDNKVTIEKEVREDEEFFKLLDETFTEYNQALKRMVDL
MITTRKLRKAGNSSVVSVPTEVIAALGISNGDNLKFNVKDNKVTIEKEVREDEEFFKLLDETFTEYNQALKRMVDL
Download Length: 231 bp
>AT200352 NZ_CP097834:c1472552-1472496 [Shigella flexneri]
TCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTC
TCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4Y7VKP2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4Y7VKS9 |