Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-doc
Location 1892429..1893054 Replicon chromosome
Accession NZ_CP073827
Organism Staphylococcus epidermidis strain B1208538

Toxin (Protein)


Gene name doc Uniprot ID Q5HMS9
Locus tag KFV36_RS09060 Protein ID WP_002504557.1
Coordinates 1892429..1892824 (-) Length 132 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A4Y7VKS9
Locus tag KFV36_RS09065 Protein ID WP_002504558.1
Coordinates 1892824..1893054 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KFV36_RS09025 (KFV36_09035) 1888097..1888501 + 405 WP_002504535.1 YolD-like family protein -
KFV36_RS13465 1888584..1888718 + 135 WP_002504536.1 hypothetical protein -
KFV36_RS09030 (KFV36_09040) 1888749..1889390 - 642 WP_002504537.1 hypothetical protein -
KFV36_RS09035 (KFV36_09045) 1889496..1890218 - 723 WP_002504538.1 hypothetical protein -
KFV36_RS09040 (KFV36_09050) 1890327..1891127 - 801 WP_000686449.1 metallophosphoesterase -
KFV36_RS09045 (KFV36_09055) 1891131..1891625 - 495 WP_010959224.1 hypothetical protein -
KFV36_RS09050 (KFV36_09060) 1891682..1891951 - 270 WP_000755772.1 hypothetical protein -
KFV36_RS09055 (KFV36_09065) 1891935..1892126 - 192 WP_002504556.1 hypothetical protein -
KFV36_RS09060 (KFV36_09070) 1892429..1892824 - 396 WP_002504557.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
KFV36_RS09065 (KFV36_09075) 1892824..1893054 - 231 WP_002504558.1 addiction module antitoxin Antitoxin
KFV36_RS09070 (KFV36_09080) 1893217..1893735 - 519 WP_002504559.1 metallophosphoesterase -
KFV36_RS09075 (KFV36_09085) 1893735..1894385 - 651 WP_002504560.1 hypothetical protein -
KFV36_RS09080 (KFV36_09090) 1894385..1894702 - 318 WP_002504561.1 hypothetical protein -
KFV36_RS09085 (KFV36_09095) 1894695..1895420 - 726 WP_010959229.1 metallophosphoesterase -
KFV36_RS09090 (KFV36_09100) 1895420..1895641 - 222 WP_002504563.1 hypothetical protein -
KFV36_RS09095 (KFV36_09105) 1895661..1895837 - 177 WP_002504564.1 hypothetical protein -
KFV36_RS09100 (KFV36_09110) 1895830..1896372 - 543 WP_002504565.1 hypothetical protein -
KFV36_RS09105 (KFV36_09115) 1896388..1896660 - 273 WP_002504566.1 hypothetical protein -
KFV36_RS09110 (KFV36_09120) 1896686..1896841 - 156 WP_002504567.1 transcriptional activator RinB -
KFV36_RS09115 (KFV36_09125) 1896838..1897122 - 285 WP_002504568.1 hypothetical protein -
KFV36_RS09120 (KFV36_09130) 1897138..1897323 - 186 WP_001187008.1 hypothetical protein -
KFV36_RS09125 (KFV36_09135) 1897308..1897487 - 180 WP_002504569.1 hypothetical protein -
KFV36_RS09130 (KFV36_09140) 1897503..1897985 - 483 WP_002504570.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage aac(6')-aph(2'') - 1858067..1993802 135735
inside Prophage aac(6')-aph(2'') - 1860857..1993802 132945


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-129)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 14992.31 Da        Isoelectric Point: 9.4885

>T200352 WP_002504557.1 NZ_CP073827:c1892824-1892429 [Staphylococcus epidermidis]
MQSTKYLTEKQVIAINVKAIQDFSPKEQVGVKVPEVLNATIEGVKQSFGGVELYETIERKAAFIYRNIAQKHAFHNANKR
TAFTSMVIFLKLNSINFECTQDEAVQFTLRVVNDKNLTLEGIETWIKRHCK

Download         Length: 396 bp

>T200352 NZ_CP097834:1472608-1472715 [Shigella flexneri]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTGCCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8648.89 Da        Isoelectric Point: 5.1231

>AT200352 WP_002504558.1 NZ_CP073827:c1893054-1892824 [Staphylococcus epidermidis]
MITTRKLRKAGNSSVVSVPTEVIAALGISNGDNLKFNVKDNKVTIEKEVREDEEFFKLLDETFTEYNQALKRMVDL

Download         Length: 231 bp

>AT200352 NZ_CP097834:c1472552-1472496 [Shigella flexneri]
TCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4Y7VKP2

Antitoxin

Source ID Structure
AlphaFold DB A0A4Y7VKS9

References