Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 10430465..10431144 | Replicon | chromosome |
| Accession | NZ_CP073797 | ||
| Organism | Dactylosporangium matsuzakiense strain NRRL B-16293 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | Dmats_RS47700 | Protein ID | WP_261962034.1 |
| Coordinates | 10430465..10430830 (+) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | Dmats_RS47705 | Protein ID | WP_261962035.1 |
| Coordinates | 10430827..10431144 (+) | Length | 106 a.a. |
Genomic Context
Location: 10426566..10427096 (531 bp)
Type: Others
Protein ID: WP_261962031.1
Type: Others
Protein ID: WP_261962031.1
Location: 10427093..10427971 (879 bp)
Type: Others
Protein ID: WP_261966267.1
Type: Others
Protein ID: WP_261966267.1
Location: 10428140..10429009 (870 bp)
Type: Others
Protein ID: WP_261966268.1
Type: Others
Protein ID: WP_261966268.1
Location: 10429653..10429856 (204 bp)
Type: Others
Protein ID: WP_261962032.1
Type: Others
Protein ID: WP_261962032.1
Location: 10429849..10430118 (270 bp)
Type: Others
Protein ID: WP_261962033.1
Type: Others
Protein ID: WP_261962033.1
Location: 10430465..10430830 (366 bp)
Type: Toxin
Protein ID: WP_261962034.1
Type: Toxin
Protein ID: WP_261962034.1
Location: 10430827..10431144 (318 bp)
Type: Antitoxin
Protein ID: WP_261962035.1
Type: Antitoxin
Protein ID: WP_261962035.1
Location: 10432522..10433340 (819 bp)
Type: Others
Protein ID: WP_261962036.1
Type: Others
Protein ID: WP_261962036.1
Location: 10433450..10434661 (1212 bp)
Type: Others
Protein ID: WP_223100066.1
Type: Others
Protein ID: WP_223100066.1
Location: 10431862..10432401 (540 bp)
Type: Others
Protein ID: WP_223100062.1
Type: Others
Protein ID: WP_223100062.1
Location: 10434669..10435061 (393 bp)
Type: Others
Protein ID: WP_261962037.1
Type: Others
Protein ID: WP_261962037.1
Location: 10435111..10435518 (408 bp)
Type: Others
Protein ID: WP_246655903.1
Type: Others
Protein ID: WP_246655903.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Dmats_RS47660 (Dmats_47430) | 10426566..10427096 | + | 531 | WP_261962031.1 | isopentenyl-diphosphate Delta-isomerase | - |
| Dmats_RS47665 (Dmats_47435) | 10427093..10427971 | + | 879 | WP_261966267.1 | MerR family transcriptional regulator | - |
| Dmats_RS47670 (Dmats_47440) | 10428140..10429009 | + | 870 | WP_261966268.1 | polysaccharide deacetylase family protein | - |
| Dmats_RS47690 (Dmats_47460) | 10429653..10429856 | + | 204 | WP_261962032.1 | hypothetical protein | - |
| Dmats_RS47695 (Dmats_47465) | 10429849..10430118 | + | 270 | WP_261962033.1 | hypothetical protein | - |
| Dmats_RS47700 (Dmats_47470) | 10430465..10430830 | + | 366 | WP_261962034.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| Dmats_RS47705 (Dmats_47475) | 10430827..10431144 | + | 318 | WP_261962035.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| Dmats_RS47710 (Dmats_47480) | 10431862..10432401 | - | 540 | WP_223100062.1 | bacterial proteasome activator family protein | - |
| Dmats_RS47715 (Dmats_47485) | 10432522..10433340 | + | 819 | WP_261962036.1 | alpha/beta fold hydrolase | - |
| Dmats_RS47720 (Dmats_47490) | 10433450..10434661 | + | 1212 | WP_223100066.1 | ABC transporter substrate-binding protein | - |
| Dmats_RS47725 (Dmats_47495) | 10434669..10435061 | - | 393 | WP_261962037.1 | hypothetical protein | - |
| Dmats_RS47730 (Dmats_47500) | 10435111..10435518 | - | 408 | WP_246655903.1 | hotdog fold thioesterase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13753.73 Da Isoelectric Point: 4.9473
>T200313 WP_261962034.1 NZ_CP073797:10430465-10430830 [Dactylosporangium matsuzakiense]
VTTPEWGIYVVDEVRAWIYSLEPTAKARVVLAIDALAENGPALGRPLVDTITHSSLANLKELRPGTMRILFVFDPWRSSI
LLVAGDKAGQWEAWYREALPLAEQRYEVYLKERAKEEGDQR
VTTPEWGIYVVDEVRAWIYSLEPTAKARVVLAIDALAENGPALGRPLVDTITHSSLANLKELRPGTMRILFVFDPWRSSI
LLVAGDKAGQWEAWYREALPLAEQRYEVYLKERAKEEGDQR
Download Length: 366 bp
>T200313 NZ_CP097828:c1716832-1716725 [Shigella flexneri]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 106 a.a. Molecular weight: 11368.78 Da Isoelectric Point: 6.4719
>AT200313 WP_261962035.1 NZ_CP073797:10430827-10431144 [Dactylosporangium matsuzakiense]
MSSYVRWSDIRAELVEQAGGEEAVAAGKQELLAEVTGHRLAEARRSRGLTQQQVADRMGVTKGRVSQIEQGKVSGQEVLA
RYAVALGGRLHQAIYFEDGDITAIA
MSSYVRWSDIRAELVEQAGGEEAVAAGKQELLAEVTGHRLAEARRSRGLTQQQVADRMGVTKGRVSQIEQGKVSGQEVLA
RYAVALGGRLHQAIYFEDGDITAIA
Download Length: 318 bp
>AT200313 NZ_CP097828:1716889-1716944 [Shigella flexneri]
TCAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
TCAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT