Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-couple_hipB |
| Location | 10311222..10311901 | Replicon | chromosome |
| Accession | NZ_CP073720 | ||
| Organism | Dactylosporangium fulvum strain NRRL B-16292 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | Dfulv_RS47535 | Protein ID | WP_259860375.1 |
| Coordinates | 10311222..10311587 (+) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | Dfulv_RS47540 | Protein ID | WP_259860376.1 |
| Coordinates | 10311584..10311901 (+) | Length | 106 a.a. |
Genomic Context
Location: 10306315..10307811 (1497 bp)
Type: Others
Protein ID: WP_259860371.1
Type: Others
Protein ID: WP_259860371.1
Location: 10307808..10308344 (537 bp)
Type: Others
Protein ID: WP_259860372.1
Type: Others
Protein ID: WP_259860372.1
Location: 10308341..10309213 (873 bp)
Type: Others
Protein ID: WP_259860373.1
Type: Others
Protein ID: WP_259860373.1
Location: 10309399..10310292 (894 bp)
Type: Others
Protein ID: WP_259860374.1
Type: Others
Protein ID: WP_259860374.1
Location: 10311222..10311587 (366 bp)
Type: Toxin
Protein ID: WP_259860375.1
Type: Toxin
Protein ID: WP_259860375.1
Location: 10311584..10311901 (318 bp)
Type: Antitoxin
Protein ID: WP_259860376.1
Type: Antitoxin
Protein ID: WP_259860376.1
Location: 10312353..10312541 (189 bp)
Type: Others
Protein ID: WP_259860377.1
Type: Others
Protein ID: WP_259860377.1
Location: 10312556..10312771 (216 bp)
Type: Others
Protein ID: WP_259860378.1
Type: Others
Protein ID: WP_259860378.1
Location: 10313127..10313705 (579 bp)
Type: Others
Protein ID: WP_259860379.1
Type: Others
Protein ID: WP_259860379.1
Location: 10316502..10316675 (174 bp)
Type: Others
Protein ID: WP_259860383.1
Type: Others
Protein ID: WP_259860383.1
Location: 10316675..10316797 (123 bp)
Type: Others
Protein ID: WP_259860384.1
Type: Others
Protein ID: WP_259860384.1
Location: 10313969..10314682 (714 bp)
Type: Others
Protein ID: WP_259860380.1
Type: Others
Protein ID: WP_259860380.1
Location: 10314752..10315480 (729 bp)
Type: Others
Protein ID: WP_259860381.1
Type: Others
Protein ID: WP_259860381.1
Location: 10315578..10315925 (348 bp)
Type: Others
Protein ID: WP_259869648.1
Type: Others
Protein ID: WP_259869648.1
Location: 10315979..10316404 (426 bp)
Type: Others
Protein ID: WP_259860382.1
Type: Others
Protein ID: WP_259860382.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Dfulv_RS47500 (Dfulv_47500) | 10306315..10307811 | + | 1497 | WP_259860371.1 | phytoene desaturase family protein | - |
| Dfulv_RS47505 (Dfulv_47505) | 10307808..10308344 | + | 537 | WP_259860372.1 | isopentenyl-diphosphate Delta-isomerase | - |
| Dfulv_RS47510 (Dfulv_47510) | 10308341..10309213 | + | 873 | WP_259860373.1 | MerR family transcriptional regulator | - |
| Dfulv_RS47515 (Dfulv_47515) | 10309399..10310292 | + | 894 | WP_259860374.1 | polysaccharide deacetylase family protein | - |
| Dfulv_RS47535 (Dfulv_47535) | 10311222..10311587 | + | 366 | WP_259860375.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| Dfulv_RS47540 (Dfulv_47540) | 10311584..10311901 | + | 318 | WP_259860376.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| Dfulv_RS47545 (Dfulv_47545) | 10312353..10312541 | + | 189 | WP_259860377.1 | type II toxin-antitoxin system HicA family toxin | - |
| Dfulv_RS47550 (Dfulv_47550) | 10312556..10312771 | + | 216 | WP_259860378.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| Dfulv_RS47555 (Dfulv_47555) | 10313127..10313705 | + | 579 | WP_259860379.1 | NUDIX domain-containing protein | - |
| Dfulv_RS47560 (Dfulv_47560) | 10313969..10314682 | - | 714 | WP_259860380.1 | AIM24 family protein | - |
| Dfulv_RS47565 (Dfulv_47565) | 10314752..10315480 | - | 729 | WP_259860381.1 | AIM24 family protein | - |
| Dfulv_RS47570 (Dfulv_47570) | 10315578..10315925 | - | 348 | WP_259869648.1 | metallopeptidase family protein | - |
| Dfulv_RS47575 (Dfulv_47575) | 10315979..10316404 | - | 426 | WP_259860382.1 | OsmC family protein | - |
| Dfulv_RS47580 (Dfulv_47580) | 10316502..10316675 | + | 174 | WP_259860383.1 | hypothetical protein | - |
| Dfulv_RS47585 (Dfulv_47585) | 10316675..10316797 | + | 123 | WP_259860384.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13806.70 Da Isoelectric Point: 5.2723
>T200129 WP_259860375.1 NZ_CP073720:10311222-10311587 [Dactylosporangium fulvum]
VTTSEWDIYVVNEVREWIRSLDPATKRRVVEAIDVLAERGPGLGRPLVDSIAHSSIVNLKELRPGTVRILFVFDPWRSSI
LLVGGDKAGRWDAWYLEAIPLAEQRYETYLKERAQEEGGRS
VTTSEWDIYVVNEVREWIRSLDPATKRRVVEAIDVLAERGPGLGRPLVDSIAHSSIVNLKELRPGTVRILFVFDPWRSSI
LLVGGDKAGRWDAWYLEAIPLAEQRYETYLKERAQEEGGRS
Download Length: 366 bp
>T200129 NZ_CP097716:224485-224592 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 106 a.a. Molecular weight: 11331.80 Da Isoelectric Point: 5.6454
>AT200129 WP_259860376.1 NZ_CP073720:10311584-10311901 [Dactylosporangium fulvum]
VSSYMRWSDIRDELVEQVGGEEVVAAGKEELLAAVIGHRLAEVRKSRGLTQQEVADRMGVTKGRVSQIEQGKVSGHDVIA
RFAAALGGRLHQAIYFDDGDIAAIA
VSSYMRWSDIRDELVEQVGGEEVVAAGKEELLAAVIGHRLAEVRKSRGLTQQEVADRMGVTKGRVSQIEQGKVSGHDVIA
RFAAALGGRLHQAIYFDDGDIAAIA
Download Length: 318 bp
>AT200129 NZ_CP097716:c224436-224373 [Escherichia coli]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT