Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 3252795..3253016 Replicon chromosome
Accession NZ_CP072980
Organism Escherichia coli strain 2547

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag KBW66_RS15905 Protein ID WP_001531632.1
Coordinates 3252795..3252902 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 3252950..3253016 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KBW66_RS15880 (3248639) 3248639..3249721 + 1083 WP_000804726.1 peptide chain release factor 1 -
KBW66_RS15885 (3249721) 3249721..3250554 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
KBW66_RS15890 (3250551) 3250551..3250943 + 393 WP_000200375.1 invasion regulator SirB2 -
KBW66_RS15895 (3250947) 3250947..3251756 + 810 WP_001257044.1 invasion regulator SirB1 -
KBW66_RS15900 (3251792) 3251792..3252646 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
KBW66_RS15905 (3252795) 3252795..3252902 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (3252952) 3252952..3253015 + 64 NuclAT_12 - -
- (3252952) 3252952..3253015 + 64 NuclAT_12 - -
- (3252952) 3252952..3253015 + 64 NuclAT_12 - -
- (3252952) 3252952..3253015 + 64 NuclAT_12 - -
- (3252952) 3252952..3253015 + 64 NuclAT_13 - -
- (3252952) 3252952..3253015 + 64 NuclAT_13 - -
- (3252952) 3252952..3253015 + 64 NuclAT_13 - -
- (3252952) 3252952..3253015 + 64 NuclAT_13 - -
- (3252952) 3252952..3253015 + 64 NuclAT_14 - -
- (3252952) 3252952..3253015 + 64 NuclAT_14 - -
- (3252952) 3252952..3253015 + 64 NuclAT_14 - -
- (3252952) 3252952..3253015 + 64 NuclAT_14 - -
- (3252952) 3252952..3253015 + 64 NuclAT_15 - -
- (3252952) 3252952..3253015 + 64 NuclAT_15 - -
- (3252952) 3252952..3253015 + 64 NuclAT_15 - -
- (3252952) 3252952..3253015 + 64 NuclAT_15 - -
- (3252952) 3252952..3253015 + 64 NuclAT_16 - -
- (3252952) 3252952..3253015 + 64 NuclAT_16 - -
- (3252952) 3252952..3253015 + 64 NuclAT_16 - -
- (3252952) 3252952..3253015 + 64 NuclAT_16 - -
- (3252952) 3252952..3253015 + 64 NuclAT_17 - -
- (3252952) 3252952..3253015 + 64 NuclAT_17 - -
- (3252952) 3252952..3253015 + 64 NuclAT_17 - -
- (3252952) 3252952..3253015 + 64 NuclAT_17 - -
- (3252950) 3252950..3253016 + 67 NuclAT_10 - Antitoxin
- (3252950) 3252950..3253016 + 67 NuclAT_10 - Antitoxin
- (3252950) 3252950..3253016 + 67 NuclAT_10 - Antitoxin
- (3252950) 3252950..3253016 + 67 NuclAT_10 - Antitoxin
- (3252950) 3252950..3253016 + 67 NuclAT_5 - Antitoxin
- (3252950) 3252950..3253016 + 67 NuclAT_5 - Antitoxin
- (3252950) 3252950..3253016 + 67 NuclAT_5 - Antitoxin
- (3252950) 3252950..3253016 + 67 NuclAT_5 - Antitoxin
- (3252950) 3252950..3253016 + 67 NuclAT_6 - Antitoxin
- (3252950) 3252950..3253016 + 67 NuclAT_6 - Antitoxin
- (3252950) 3252950..3253016 + 67 NuclAT_6 - Antitoxin
- (3252950) 3252950..3253016 + 67 NuclAT_6 - Antitoxin
- (3252950) 3252950..3253016 + 67 NuclAT_7 - Antitoxin
- (3252950) 3252950..3253016 + 67 NuclAT_7 - Antitoxin
- (3252950) 3252950..3253016 + 67 NuclAT_7 - Antitoxin
- (3252950) 3252950..3253016 + 67 NuclAT_7 - Antitoxin
- (3252950) 3252950..3253016 + 67 NuclAT_8 - Antitoxin
- (3252950) 3252950..3253016 + 67 NuclAT_8 - Antitoxin
- (3252950) 3252950..3253016 + 67 NuclAT_8 - Antitoxin
- (3252950) 3252950..3253016 + 67 NuclAT_8 - Antitoxin
- (3252950) 3252950..3253016 + 67 NuclAT_9 - Antitoxin
- (3252950) 3252950..3253016 + 67 NuclAT_9 - Antitoxin
- (3252950) 3252950..3253016 + 67 NuclAT_9 - Antitoxin
- (3252950) 3252950..3253016 + 67 NuclAT_9 - Antitoxin
- (3252952) 3252952..3253017 + 66 NuclAT_18 - -
- (3252952) 3252952..3253017 + 66 NuclAT_18 - -
- (3252952) 3252952..3253017 + 66 NuclAT_18 - -
- (3252952) 3252952..3253017 + 66 NuclAT_18 - -
- (3252952) 3252952..3253017 + 66 NuclAT_19 - -
- (3252952) 3252952..3253017 + 66 NuclAT_19 - -
- (3252952) 3252952..3253017 + 66 NuclAT_19 - -
- (3252952) 3252952..3253017 + 66 NuclAT_19 - -
- (3252952) 3252952..3253017 + 66 NuclAT_20 - -
- (3252952) 3252952..3253017 + 66 NuclAT_20 - -
- (3252952) 3252952..3253017 + 66 NuclAT_20 - -
- (3252952) 3252952..3253017 + 66 NuclAT_20 - -
- (3252952) 3252952..3253017 + 66 NuclAT_21 - -
- (3252952) 3252952..3253017 + 66 NuclAT_21 - -
- (3252952) 3252952..3253017 + 66 NuclAT_21 - -
- (3252952) 3252952..3253017 + 66 NuclAT_21 - -
- (3252952) 3252952..3253017 + 66 NuclAT_22 - -
- (3252952) 3252952..3253017 + 66 NuclAT_22 - -
- (3252952) 3252952..3253017 + 66 NuclAT_22 - -
- (3252952) 3252952..3253017 + 66 NuclAT_22 - -
- (3252952) 3252952..3253017 + 66 NuclAT_23 - -
- (3252952) 3252952..3253017 + 66 NuclAT_23 - -
- (3252952) 3252952..3253017 + 66 NuclAT_23 - -
- (3252952) 3252952..3253017 + 66 NuclAT_23 - -
KBW66_RS15910 (3253307) 3253307..3254407 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
KBW66_RS15915 (3254677) 3254677..3254916 + 240 WP_000120702.1 putative cation transport regulator ChaB -
KBW66_RS15920 (3255065) 3255065..3255760 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
KBW66_RS15925 (3255804) 3255804..3256157 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
KBW66_RS15930 (3256342) 3256342..3257736 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T199371 WP_001531632.1 NZ_CP072980:c3252902-3252795 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T199371 NZ_CP097330:c2595537-2595277 [Cupriavidus campinensis]
ATGACCCGCAAGGTCTTATTCACGCCGGATGCACGGGAAGACTATGTGTATTGGCAGGGTCAGGATCGTAAAACCCTGAA
ACGCATCAATCAGTTGATCAAGGAAGTGCAACGCACGCCGTTCGAGGGGATTGGCAAGCCCGAGCCTTTGGTCGGCAACC
TCACCGGCTTCTGGTCGAGGCGGATCGATGATGCGAACCGCCTCGTCTATGAAGCCACGGAAGACCAGGTCAACATCGTG
GCTTGCCGCTATCACTATTGA

Antitoxin


Download         Length: 67 bp

>AT199371 NZ_CP072980:3252950-3253016 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References