Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2709515..2709735 | Replicon | chromosome |
| Accession | NZ_CP072858 | ||
| Organism | Escherichia coli strain 184/2aE | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | D3H2K1 |
| Locus tag | J9158_RS13090 | Protein ID | WP_000170955.1 |
| Coordinates | 2709628..2709735 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2709515..2709581 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| J9158_RS13060 | 2705303..2705656 | + | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| J9158_RS13065 | 2705700..2706395 | - | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| J9158_RS13070 | 2706553..2706783 | - | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| J9158_RS13075 | 2707053..2708153 | + | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
| - | 2708443..2708510 | - | 68 | NuclAT_38 | - | - |
| - | 2708443..2708510 | - | 68 | NuclAT_38 | - | - |
| - | 2708443..2708510 | - | 68 | NuclAT_38 | - | - |
| - | 2708443..2708510 | - | 68 | NuclAT_38 | - | - |
| - | 2708443..2708510 | - | 68 | NuclAT_41 | - | - |
| - | 2708443..2708510 | - | 68 | NuclAT_41 | - | - |
| - | 2708443..2708510 | - | 68 | NuclAT_41 | - | - |
| - | 2708443..2708510 | - | 68 | NuclAT_41 | - | - |
| - | 2708443..2708510 | - | 68 | NuclAT_44 | - | - |
| - | 2708443..2708510 | - | 68 | NuclAT_44 | - | - |
| - | 2708443..2708510 | - | 68 | NuclAT_44 | - | - |
| - | 2708443..2708510 | - | 68 | NuclAT_44 | - | - |
| - | 2708443..2708510 | - | 68 | NuclAT_47 | - | - |
| - | 2708443..2708510 | - | 68 | NuclAT_47 | - | - |
| - | 2708443..2708510 | - | 68 | NuclAT_47 | - | - |
| - | 2708443..2708510 | - | 68 | NuclAT_47 | - | - |
| - | 2708443..2708510 | - | 68 | NuclAT_50 | - | - |
| - | 2708443..2708510 | - | 68 | NuclAT_50 | - | - |
| - | 2708443..2708510 | - | 68 | NuclAT_50 | - | - |
| - | 2708443..2708510 | - | 68 | NuclAT_50 | - | - |
| - | 2708443..2708510 | - | 68 | NuclAT_53 | - | - |
| - | 2708443..2708510 | - | 68 | NuclAT_53 | - | - |
| - | 2708443..2708510 | - | 68 | NuclAT_53 | - | - |
| - | 2708443..2708510 | - | 68 | NuclAT_53 | - | - |
| - | 2708445..2708510 | - | 66 | NuclAT_18 | - | - |
| - | 2708445..2708510 | - | 66 | NuclAT_18 | - | - |
| - | 2708445..2708510 | - | 66 | NuclAT_18 | - | - |
| - | 2708445..2708510 | - | 66 | NuclAT_18 | - | - |
| - | 2708445..2708510 | - | 66 | NuclAT_21 | - | - |
| - | 2708445..2708510 | - | 66 | NuclAT_21 | - | - |
| - | 2708445..2708510 | - | 66 | NuclAT_21 | - | - |
| - | 2708445..2708510 | - | 66 | NuclAT_21 | - | - |
| - | 2708445..2708510 | - | 66 | NuclAT_24 | - | - |
| - | 2708445..2708510 | - | 66 | NuclAT_24 | - | - |
| - | 2708445..2708510 | - | 66 | NuclAT_24 | - | - |
| - | 2708445..2708510 | - | 66 | NuclAT_24 | - | - |
| - | 2708445..2708510 | - | 66 | NuclAT_27 | - | - |
| - | 2708445..2708510 | - | 66 | NuclAT_27 | - | - |
| - | 2708445..2708510 | - | 66 | NuclAT_27 | - | - |
| - | 2708445..2708510 | - | 66 | NuclAT_27 | - | - |
| - | 2708445..2708510 | - | 66 | NuclAT_32 | - | - |
| - | 2708445..2708510 | - | 66 | NuclAT_32 | - | - |
| - | 2708445..2708510 | - | 66 | NuclAT_32 | - | - |
| - | 2708445..2708510 | - | 66 | NuclAT_32 | - | - |
| - | 2708445..2708510 | - | 66 | NuclAT_35 | - | - |
| - | 2708445..2708510 | - | 66 | NuclAT_35 | - | - |
| - | 2708445..2708510 | - | 66 | NuclAT_35 | - | - |
| - | 2708445..2708510 | - | 66 | NuclAT_35 | - | - |
| J9158_RS13080 | 2708558..2708665 | + | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2708978..2709045 | - | 68 | NuclAT_37 | - | - |
| - | 2708978..2709045 | - | 68 | NuclAT_37 | - | - |
| - | 2708978..2709045 | - | 68 | NuclAT_37 | - | - |
| - | 2708978..2709045 | - | 68 | NuclAT_37 | - | - |
| - | 2708978..2709045 | - | 68 | NuclAT_40 | - | - |
| - | 2708978..2709045 | - | 68 | NuclAT_40 | - | - |
| - | 2708978..2709045 | - | 68 | NuclAT_40 | - | - |
| - | 2708978..2709045 | - | 68 | NuclAT_40 | - | - |
| - | 2708978..2709045 | - | 68 | NuclAT_43 | - | - |
| - | 2708978..2709045 | - | 68 | NuclAT_43 | - | - |
| - | 2708978..2709045 | - | 68 | NuclAT_43 | - | - |
| - | 2708978..2709045 | - | 68 | NuclAT_43 | - | - |
| - | 2708978..2709045 | - | 68 | NuclAT_46 | - | - |
| - | 2708978..2709045 | - | 68 | NuclAT_46 | - | - |
| - | 2708978..2709045 | - | 68 | NuclAT_46 | - | - |
| - | 2708978..2709045 | - | 68 | NuclAT_46 | - | - |
| - | 2708978..2709045 | - | 68 | NuclAT_49 | - | - |
| - | 2708978..2709045 | - | 68 | NuclAT_49 | - | - |
| - | 2708978..2709045 | - | 68 | NuclAT_49 | - | - |
| - | 2708978..2709045 | - | 68 | NuclAT_49 | - | - |
| - | 2708978..2709045 | - | 68 | NuclAT_52 | - | - |
| - | 2708978..2709045 | - | 68 | NuclAT_52 | - | - |
| - | 2708978..2709045 | - | 68 | NuclAT_52 | - | - |
| - | 2708978..2709045 | - | 68 | NuclAT_52 | - | - |
| - | 2708980..2709045 | - | 66 | NuclAT_17 | - | - |
| - | 2708980..2709045 | - | 66 | NuclAT_17 | - | - |
| - | 2708980..2709045 | - | 66 | NuclAT_17 | - | - |
| - | 2708980..2709045 | - | 66 | NuclAT_17 | - | - |
| - | 2708980..2709045 | - | 66 | NuclAT_20 | - | - |
| - | 2708980..2709045 | - | 66 | NuclAT_20 | - | - |
| - | 2708980..2709045 | - | 66 | NuclAT_20 | - | - |
| - | 2708980..2709045 | - | 66 | NuclAT_20 | - | - |
| - | 2708980..2709045 | - | 66 | NuclAT_23 | - | - |
| - | 2708980..2709045 | - | 66 | NuclAT_23 | - | - |
| - | 2708980..2709045 | - | 66 | NuclAT_23 | - | - |
| - | 2708980..2709045 | - | 66 | NuclAT_23 | - | - |
| - | 2708980..2709045 | - | 66 | NuclAT_26 | - | - |
| - | 2708980..2709045 | - | 66 | NuclAT_26 | - | - |
| - | 2708980..2709045 | - | 66 | NuclAT_26 | - | - |
| - | 2708980..2709045 | - | 66 | NuclAT_26 | - | - |
| - | 2708980..2709045 | - | 66 | NuclAT_31 | - | - |
| - | 2708980..2709045 | - | 66 | NuclAT_31 | - | - |
| - | 2708980..2709045 | - | 66 | NuclAT_31 | - | - |
| - | 2708980..2709045 | - | 66 | NuclAT_31 | - | - |
| - | 2708980..2709045 | - | 66 | NuclAT_34 | - | - |
| - | 2708980..2709045 | - | 66 | NuclAT_34 | - | - |
| - | 2708980..2709045 | - | 66 | NuclAT_34 | - | - |
| - | 2708980..2709045 | - | 66 | NuclAT_34 | - | - |
| J9158_RS13085 | 2709093..2709200 | + | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2709515..2709581 | - | 67 | - | - | Antitoxin |
| J9158_RS13090 | 2709628..2709735 | + | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| J9158_RS13095 | 2709884..2710738 | - | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| J9158_RS13100 | 2710774..2711583 | - | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| J9158_RS13105 | 2711587..2711979 | - | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| J9158_RS13110 | 2711976..2712809 | - | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| J9158_RS13115 | 2712809..2713891 | - | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4013.82 Da Isoelectric Point: 11.4779
>T199043 WP_000170955.1 NZ_CP072858:2709628-2709735 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T199043 NZ_CP097127:c2525052-2524804 [Conexibacter sp. S30A1]
TTGGCGATCACAGCAAGCGAAGCACGGCGGGCGTTGTTCCCGCTCATCGAGAAGGTCAACGACGACCGCACTGCGATCGA
GATCACGTCCAAGCGCGGCAACGCGGTACTGATGGCCGCCGAGGATTACGCAGCATGGCAGGAGACCGCCTATCTGTTCC
GCTCTCCCGCAAATGCTCGCCGCTTGCTTGATGCCGCCGAGGCCGCCGAACGCGGCGAATTCGCAGAGCATCCGCTCGAT
CGCGAGTGA
TTGGCGATCACAGCAAGCGAAGCACGGCGGGCGTTGTTCCCGCTCATCGAGAAGGTCAACGACGACCGCACTGCGATCGA
GATCACGTCCAAGCGCGGCAACGCGGTACTGATGGCCGCCGAGGATTACGCAGCATGGCAGGAGACCGCCTATCTGTTCC
GCTCTCCCGCAAATGCTCGCCGCTTGCTTGATGCCGCCGAGGCCGCCGAACGCGGCGAATTCGCAGAGCATCCGCTCGAT
CGCGAGTGA
Antitoxin
Download Length: 67 bp
>AT199043 NZ_CP072858:c2709581-2709515 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|