Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2708980..2709200 Replicon chromosome
Accession NZ_CP072858
Organism Escherichia coli strain 184/2aE

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag J9158_RS13085 Protein ID WP_000170955.1
Coordinates 2709093..2709200 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2708980..2709046 (-)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
J9158_RS13060 2705303..2705656 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
J9158_RS13065 2705700..2706395 - 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
J9158_RS13070 2706553..2706783 - 231 WP_001146444.1 putative cation transport regulator ChaB -
J9158_RS13075 2707053..2708153 + 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
- 2708443..2708510 - 68 NuclAT_38 - -
- 2708443..2708510 - 68 NuclAT_38 - -
- 2708443..2708510 - 68 NuclAT_38 - -
- 2708443..2708510 - 68 NuclAT_38 - -
- 2708443..2708510 - 68 NuclAT_41 - -
- 2708443..2708510 - 68 NuclAT_41 - -
- 2708443..2708510 - 68 NuclAT_41 - -
- 2708443..2708510 - 68 NuclAT_41 - -
- 2708443..2708510 - 68 NuclAT_44 - -
- 2708443..2708510 - 68 NuclAT_44 - -
- 2708443..2708510 - 68 NuclAT_44 - -
- 2708443..2708510 - 68 NuclAT_44 - -
- 2708443..2708510 - 68 NuclAT_47 - -
- 2708443..2708510 - 68 NuclAT_47 - -
- 2708443..2708510 - 68 NuclAT_47 - -
- 2708443..2708510 - 68 NuclAT_47 - -
- 2708443..2708510 - 68 NuclAT_50 - -
- 2708443..2708510 - 68 NuclAT_50 - -
- 2708443..2708510 - 68 NuclAT_50 - -
- 2708443..2708510 - 68 NuclAT_50 - -
- 2708443..2708510 - 68 NuclAT_53 - -
- 2708443..2708510 - 68 NuclAT_53 - -
- 2708443..2708510 - 68 NuclAT_53 - -
- 2708443..2708510 - 68 NuclAT_53 - -
- 2708445..2708510 - 66 NuclAT_18 - -
- 2708445..2708510 - 66 NuclAT_18 - -
- 2708445..2708510 - 66 NuclAT_18 - -
- 2708445..2708510 - 66 NuclAT_18 - -
- 2708445..2708510 - 66 NuclAT_21 - -
- 2708445..2708510 - 66 NuclAT_21 - -
- 2708445..2708510 - 66 NuclAT_21 - -
- 2708445..2708510 - 66 NuclAT_21 - -
- 2708445..2708510 - 66 NuclAT_24 - -
- 2708445..2708510 - 66 NuclAT_24 - -
- 2708445..2708510 - 66 NuclAT_24 - -
- 2708445..2708510 - 66 NuclAT_24 - -
- 2708445..2708510 - 66 NuclAT_27 - -
- 2708445..2708510 - 66 NuclAT_27 - -
- 2708445..2708510 - 66 NuclAT_27 - -
- 2708445..2708510 - 66 NuclAT_27 - -
- 2708445..2708510 - 66 NuclAT_32 - -
- 2708445..2708510 - 66 NuclAT_32 - -
- 2708445..2708510 - 66 NuclAT_32 - -
- 2708445..2708510 - 66 NuclAT_32 - -
- 2708445..2708510 - 66 NuclAT_35 - -
- 2708445..2708510 - 66 NuclAT_35 - -
- 2708445..2708510 - 66 NuclAT_35 - -
- 2708445..2708510 - 66 NuclAT_35 - -
J9158_RS13080 2708558..2708665 + 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2708980..2709046 - 67 - - Antitoxin
J9158_RS13085 2709093..2709200 + 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2709513..2709580 - 68 NuclAT_36 - -
- 2709513..2709580 - 68 NuclAT_36 - -
- 2709513..2709580 - 68 NuclAT_36 - -
- 2709513..2709580 - 68 NuclAT_36 - -
- 2709513..2709580 - 68 NuclAT_39 - -
- 2709513..2709580 - 68 NuclAT_39 - -
- 2709513..2709580 - 68 NuclAT_39 - -
- 2709513..2709580 - 68 NuclAT_39 - -
- 2709513..2709580 - 68 NuclAT_42 - -
- 2709513..2709580 - 68 NuclAT_42 - -
- 2709513..2709580 - 68 NuclAT_42 - -
- 2709513..2709580 - 68 NuclAT_42 - -
- 2709513..2709580 - 68 NuclAT_45 - -
- 2709513..2709580 - 68 NuclAT_45 - -
- 2709513..2709580 - 68 NuclAT_45 - -
- 2709513..2709580 - 68 NuclAT_45 - -
- 2709513..2709580 - 68 NuclAT_48 - -
- 2709513..2709580 - 68 NuclAT_48 - -
- 2709513..2709580 - 68 NuclAT_48 - -
- 2709513..2709580 - 68 NuclAT_48 - -
- 2709513..2709580 - 68 NuclAT_51 - -
- 2709513..2709580 - 68 NuclAT_51 - -
- 2709513..2709580 - 68 NuclAT_51 - -
- 2709513..2709580 - 68 NuclAT_51 - -
- 2709515..2709580 - 66 NuclAT_16 - -
- 2709515..2709580 - 66 NuclAT_16 - -
- 2709515..2709580 - 66 NuclAT_16 - -
- 2709515..2709580 - 66 NuclAT_16 - -
- 2709515..2709580 - 66 NuclAT_19 - -
- 2709515..2709580 - 66 NuclAT_19 - -
- 2709515..2709580 - 66 NuclAT_19 - -
- 2709515..2709580 - 66 NuclAT_19 - -
- 2709515..2709580 - 66 NuclAT_22 - -
- 2709515..2709580 - 66 NuclAT_22 - -
- 2709515..2709580 - 66 NuclAT_22 - -
- 2709515..2709580 - 66 NuclAT_22 - -
- 2709515..2709580 - 66 NuclAT_25 - -
- 2709515..2709580 - 66 NuclAT_25 - -
- 2709515..2709580 - 66 NuclAT_25 - -
- 2709515..2709580 - 66 NuclAT_25 - -
- 2709515..2709580 - 66 NuclAT_30 - -
- 2709515..2709580 - 66 NuclAT_30 - -
- 2709515..2709580 - 66 NuclAT_30 - -
- 2709515..2709580 - 66 NuclAT_30 - -
- 2709515..2709580 - 66 NuclAT_33 - -
- 2709515..2709580 - 66 NuclAT_33 - -
- 2709515..2709580 - 66 NuclAT_33 - -
- 2709515..2709580 - 66 NuclAT_33 - -
J9158_RS13090 2709628..2709735 + 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
J9158_RS13095 2709884..2710738 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
J9158_RS13100 2710774..2711583 - 810 WP_001257044.1 invasion regulator SirB1 -
J9158_RS13105 2711587..2711979 - 393 WP_000200374.1 invasion regulator SirB2 -
J9158_RS13110 2711976..2712809 - 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
J9158_RS13115 2712809..2713891 - 1083 WP_000804726.1 peptide chain release factor 1 -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T199042 WP_000170955.1 NZ_CP072858:2709093-2709200 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T199042 NZ_CP097127:c2524807-2524547 [Conexibacter sp. S30A1]
GTGAGGCTTGTCTTCACTCCCCAAGGCTGGGACGACTATTGCCACTGGCAGCAGTCCGATCGCTCGATCCTGAAGCGGAT
CAACCGGCTGATCGATGACGCGCTGCGCGACCCGACATCCGGAATCGGGAAACCAGAGCCACTCAAGTACGGAATCACCG
GGACGTGGTCACGACGAATCACCGATGAGCACCGACTCGTCTACCGCGTCCTCAACGATGACCTCGTGATCCTTCAGGCT
CGTTACCACTACCAGAAATAG

Antitoxin


Download         Length: 67 bp

>AT199042 NZ_CP072858:c2709046-2708980 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A829J2A9


Antitoxin

Download structure file

References