Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1565235..1565788 | Replicon | chromosome |
Accession | NZ_CP072801 | ||
Organism | Thiothrix litoralis strain AS |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | J9253_RS07630 | Protein ID | WP_266097388.1 |
Coordinates | 1565235..1565330 (+) | Length | 32 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | J9253_RS07635 | Protein ID | WP_210224019.1 |
Coordinates | 1565330..1565788 (+) | Length | 153 a.a. |
Genomic Context
Location: 1564930..1565106 (177 bp)
Type: Others
Protein ID: WP_210224018.1
Type: Others
Protein ID: WP_210224018.1
Location: 1565235..1565330 (96 bp)
Type: Toxin
Protein ID: WP_266097388.1
Type: Toxin
Protein ID: WP_266097388.1
Location: 1565330..1565788 (459 bp)
Type: Antitoxin
Protein ID: WP_210224019.1
Type: Antitoxin
Protein ID: WP_210224019.1
Location: 1566026..1566661 (636 bp)
Type: Others
Protein ID: WP_210224020.1
Type: Others
Protein ID: WP_210224020.1
Location: 1566861..1568144 (1284 bp)
Type: Others
Protein ID: WP_210224021.1
Type: Others
Protein ID: WP_210224021.1
Location: 1568194..1568670 (477 bp)
Type: Others
Protein ID: WP_210224022.1
Type: Others
Protein ID: WP_210224022.1
Location: 1568667..1569677 (1011 bp)
Type: Others
Protein ID: WP_210224023.1
Type: Others
Protein ID: WP_210224023.1
Location: 1560491..1561024 (534 bp)
Type: Others
Protein ID: WP_210224011.1
Type: Others
Protein ID: WP_210224011.1
Location: 1561043..1562302 (1260 bp)
Type: Others
Protein ID: WP_210224012.1
Type: Others
Protein ID: WP_210224012.1
Location: 1562732..1562989 (258 bp)
Type: Others
Protein ID: WP_210224013.1
Type: Others
Protein ID: WP_210224013.1
Location: 1563003..1563305 (303 bp)
Type: Others
Protein ID: WP_210224014.1
Type: Others
Protein ID: WP_210224014.1
Location: 1563283..1563630 (348 bp)
Type: Others
Protein ID: WP_210224015.1
Type: Others
Protein ID: WP_210224015.1
Location: 1563655..1564188 (534 bp)
Type: Others
Protein ID: WP_210224016.1
Type: Others
Protein ID: WP_210224016.1
Location: 1564207..1564647 (441 bp)
Type: Others
Protein ID: WP_266097376.1
Type: Others
Protein ID: WP_266097376.1
Location: 1564656..1564826 (171 bp)
Type: Others
Protein ID: WP_210224017.1
Type: Others
Protein ID: WP_210224017.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
J9253_RS07585 (J9253_07585) | 1560491..1561024 | - | 534 | WP_210224011.1 | ProQ/FINO family protein | - |
J9253_RS07590 (J9253_07590) | 1561043..1562302 | - | 1260 | WP_210224012.1 | tyrosine-type recombinase/integrase | - |
J9253_RS07595 (J9253_07595) | 1562732..1562989 | - | 258 | WP_210224013.1 | BrnA antitoxin family protein | - |
J9253_RS07600 (J9253_07600) | 1563003..1563305 | - | 303 | WP_210224014.1 | putative addiction module antidote protein | - |
J9253_RS07605 (J9253_07605) | 1563283..1563630 | - | 348 | WP_210224015.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
J9253_RS07610 (J9253_07610) | 1563655..1564188 | - | 534 | WP_210224016.1 | ProQ/FINO family protein | - |
J9253_RS07615 (J9253_07615) | 1564207..1564647 | - | 441 | WP_266097376.1 | hypothetical protein | - |
J9253_RS07620 (J9253_07620) | 1564656..1564826 | - | 171 | WP_210224017.1 | hypothetical protein | - |
J9253_RS07625 (J9253_07625) | 1564930..1565106 | + | 177 | WP_210224018.1 | DUF853 family protein | - |
J9253_RS07630 (J9253_07630) | 1565235..1565330 | + | 96 | WP_266097388.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
J9253_RS07635 (J9253_07635) | 1565330..1565788 | + | 459 | WP_210224019.1 | transcriptional regulator | Antitoxin |
J9253_RS07640 (J9253_07640) | 1566026..1566661 | + | 636 | WP_210224020.1 | hypothetical protein | - |
J9253_RS07645 (J9253_07645) | 1566861..1568144 | + | 1284 | WP_210224021.1 | FAD-dependent oxidoreductase | - |
J9253_RS07650 (J9253_07650) | 1568194..1568670 | + | 477 | WP_210224022.1 | hypothetical protein | - |
J9253_RS07655 (J9253_07655) | 1568667..1569677 | + | 1011 | WP_210224023.1 | HlyD family secretion protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3829.37 Da Isoelectric Point: 8.0304
>T198886 WP_266097388.1 NZ_CP072801:1565235-1565330 [Thiothrix litoralis]
IEFRDNRMYVKHIVTHADYDKLCKKYAREAD
IEFRDNRMYVKHIVTHADYDKLCKKYAREAD
Download Length: 96 bp
>T198886 NZ_CP097046:c2608396-2608253 [Enterococcus faecalis]
ATGAGCGTACTTCCAAAATTTACAGAAAGGAGAGGCCTGTTGTCAGCATATGAAACAATTCAGACGATCCTAGGGTTTGG
TATGTTTACCATTGCTTTGATTGCGCTGATTGTGAAATTGCTTAAAAATGACAATAAAAAATAA
ATGAGCGTACTTCCAAAATTTACAGAAAGGAGAGGCCTGTTGTCAGCATATGAAACAATTCAGACGATCCTAGGGTTTGG
TATGTTTACCATTGCTTTGATTGCGCTGATTGTGAAATTGCTTAAAAATGACAATAAAAAATAA
Antitoxin
Download Length: 153 a.a. Molecular weight: 17257.60 Da Isoelectric Point: 4.7387
>AT198886 WP_210224019.1 NZ_CP072801:1565330-1565788 [Thiothrix litoralis]
MDFAAVKTKAKELFAQASFISEIKHEADYENALALMEELLEDYDEHRTLIGILANAIEEWENVAPEFAEFNQRVAQLDDG
VAVLRTLIDQYQLKAEDLKNEIGSKSLVSMILNGSRNMTREHIQALSLRFNLNPAIFFHTTGLRLVSTSRKT
MDFAAVKTKAKELFAQASFISEIKHEADYENALALMEELLEDYDEHRTLIGILANAIEEWENVAPEFAEFNQRVAQLDDG
VAVLRTLIDQYQLKAEDLKNEIGSKSLVSMILNGSRNMTREHIQALSLRFNLNPAIFFHTTGLRLVSTSRKT
Download Length: 459 bp
>AT198886 NZ_CP097046:2608134-2608320 [Enterococcus faecalis]
TGTGCTATAATGAAAACGAAAAGAGAGATATGCGTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCGATT
TTGTTACAAAAAATAACCGTACTCGATCAAAGTAAACGGTTATTTTTTATTGTCATTTTTAAGCAATTTCACAATCAGCG
CAATCAAAGCAATGGTAAACATACCAA
TGTGCTATAATGAAAACGAAAAGAGAGATATGCGTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCGATT
TTGTTACAAAAAATAACCGTACTCGATCAAAGTAAACGGTTATTTTTTATTGTCATTTTTAAGCAATTTCACAATCAGCG
CAATCAAAGCAATGGTAAACATACCAA