Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 1887352..1887985 | Replicon | chromosome |
Accession | NZ_CP072793 | ||
Organism | Thiothrix unzii strain A1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | J9260_RS09420 | Protein ID | WP_210217543.1 |
Coordinates | 1887352..1887684 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | J9260_RS09425 | Protein ID | WP_202717404.1 |
Coordinates | 1887671..1887985 (+) | Length | 105 a.a. |
Genomic Context
Location: 1885008..1885286 (279 bp)
Type: Others
Protein ID: WP_210217539.1
Type: Others
Protein ID: WP_210217539.1
Location: 1885283..1885720 (438 bp)
Type: Others
Protein ID: WP_210217540.1
Type: Others
Protein ID: WP_210217540.1
Location: 1887094..1887315 (222 bp)
Type: Others
Protein ID: WP_210217542.1
Type: Others
Protein ID: WP_210217542.1
Location: 1887352..1887684 (333 bp)
Type: Toxin
Protein ID: WP_210217543.1
Type: Toxin
Protein ID: WP_210217543.1
Location: 1887671..1887985 (315 bp)
Type: Antitoxin
Protein ID: WP_202717404.1
Type: Antitoxin
Protein ID: WP_202717404.1
Location: 1885820..1886788 (969 bp)
Type: Others
Protein ID: WP_210217541.1
Type: Others
Protein ID: WP_210217541.1
Location: 1888099..1888644 (546 bp)
Type: Others
Protein ID: WP_210217544.1
Type: Others
Protein ID: WP_210217544.1
Location: 1888646..1889218 (573 bp)
Type: Others
Protein ID: WP_210217545.1
Type: Others
Protein ID: WP_210217545.1
Location: 1889218..1889757 (540 bp)
Type: Others
Protein ID: WP_210217546.1
Type: Others
Protein ID: WP_210217546.1
Location: 1889885..1890385 (501 bp)
Type: Others
Protein ID: WP_210217547.1
Type: Others
Protein ID: WP_210217547.1
Location: 1890379..1891527 (1149 bp)
Type: Others
Protein ID: WP_210217548.1
Type: Others
Protein ID: WP_210217548.1
Location: 1891532..1892314 (783 bp)
Type: Others
Protein ID: WP_210217549.1
Type: Others
Protein ID: WP_210217549.1
Location: 1892311..1892763 (453 bp)
Type: Others
Protein ID: WP_210217550.1
Type: Others
Protein ID: WP_210217550.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
J9260_RS09400 (J9260_09395) | 1885008..1885286 | + | 279 | WP_210217539.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
J9260_RS09405 (J9260_09400) | 1885283..1885720 | + | 438 | WP_210217540.1 | type II toxin-antitoxin system VapC family toxin | - |
J9260_RS09410 (J9260_09405) | 1885820..1886788 | - | 969 | WP_210217541.1 | DUF1566 domain-containing protein | - |
J9260_RS09415 (J9260_09410) | 1887094..1887315 | + | 222 | WP_210217542.1 | hypothetical protein | - |
J9260_RS09420 (J9260_09415) | 1887352..1887684 | + | 333 | WP_210217543.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
J9260_RS09425 (J9260_09420) | 1887671..1887985 | + | 315 | WP_202717404.1 | hypothetical protein | Antitoxin |
J9260_RS09430 (J9260_09425) | 1888099..1888644 | - | 546 | WP_210217544.1 | gamma carbonic anhydrase family protein | - |
J9260_RS09435 (J9260_09430) | 1888646..1889218 | - | 573 | WP_210217545.1 | ribonuclease HII | - |
J9260_RS09440 (J9260_09435) | 1889218..1889757 | - | 540 | WP_210217546.1 | hypothetical protein | - |
J9260_RS09445 (J9260_09440) | 1889885..1890385 | - | 501 | WP_210217547.1 | class II aldolase/adducin family protein | - |
J9260_RS09450 (J9260_09445) | 1890379..1891527 | - | 1149 | WP_210217548.1 | lipid-A-disaccharide synthase | - |
J9260_RS09455 (J9260_09450) | 1891532..1892314 | - | 783 | WP_210217549.1 | acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase | - |
J9260_RS09460 (J9260_09455) | 1892311..1892763 | - | 453 | WP_210217550.1 | 3-hydroxyacyl-ACP dehydratase FabZ | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12848.57 Da Isoelectric Point: 8.3571
>T198865 WP_210217543.1 NZ_CP072793:1887352-1887684 [Thiothrix unzii]
MKAVFVESTIFEKHRSAYLPDDEFQQFQSDLLENPLVGDVIQGTGGLRKVRVGIQGRGKRGGARVIYYYYDSFQRFYLLT
IYAKNEMSDLTADQKHQLKTFMEVWRNEQA
MKAVFVESTIFEKHRSAYLPDDEFQQFQSDLLENPLVGDVIQGTGGLRKVRVGIQGRGKRGGARVIYYYYDSFQRFYLLT
IYAKNEMSDLTADQKHQLKTFMEVWRNEQA
Download Length: 333 bp
>T198865 NZ_CP097038:c300570-300475 [Enterococcus faecalis]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACAAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACAAGGAATAA
Antitoxin
Download Length: 105 a.a. Molecular weight: 11873.64 Da Isoelectric Point: 10.4451
>AT198865 WP_202717404.1 NZ_CP072793:1887671-1887985 [Thiothrix unzii]
MSKRNLFEELSTALVEAKQHSEGKLTLRTHVVQRAGVPEIKPQEILTIREMFNMSRGVFARHLHTSARTLESWEQGRTAP
NGQAVTLLRLVQRHPETLSYIAEL
MSKRNLFEELSTALVEAKQHSEGKLTLRTHVVQRAGVPEIKPQEILTIREMFNMSRGVFARHLHTSARTLESWEQGRTAP
NGQAVTLLRLVQRHPETLSYIAEL
Download Length: 315 bp
>AT198865 NZ_CP097038:300376-300440 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT