Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 849514..849772 | Replicon | chromosome |
Accession | NZ_CP072787 | ||
Organism | Escherichia coli strain NC101 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | I0P59_RS03930 | Protein ID | WP_000809168.1 |
Coordinates | 849514..849666 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 849715..849772 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
I0P59_RS03910 | 844759..845472 | - | 714 | WP_001102393.1 | acidic protein MsyB | - |
I0P59_RS03915 | 845498..845902 | - | 405 | WP_000843692.1 | DUF2541 family protein | - |
I0P59_RS03920 | 846274..848190 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
I0P59_RS03925 | 848279..849409 | + | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
I0P59_RS03930 | 849514..849666 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
- | 849715..849772 | + | 58 | - | - | Antitoxin |
I0P59_RS03935 | 850281..851042 | + | 762 | WP_001274832.1 | outer membrane protein OmpK | - |
I0P59_RS03940 | 851062..852555 | + | 1494 | WP_001350365.1 | sulfatase-like hydrolase/transferase | - |
I0P59_RS03945 | 852684..853943 | + | 1260 | WP_000494929.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T198776 WP_000809168.1 NZ_CP072787:c849666-849514 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
>T198776 NZ_CP097002:473441-473557 [Enterococcus faecalis]
ATGTTTTTGTCCGTTGAAGCAGCGCTAGGACTGATGATTGGTTTTGCAACACTTGTTGTGACCATTATCTTCGGTATCTT
AGCGCTTGTCTTAGACAACAAAAATAACCGTTCATAA
ATGTTTTTGTCCGTTGAAGCAGCGCTAGGACTGATGATTGGTTTTGCAACACTTGTTGTGACCATTATCTTCGGTATCTT
AGCGCTTGTCTTAGACAACAAAAATAACCGTTCATAA
Antitoxin
Download Length: 58 bp
>AT198776 NZ_CP072787:849715-849772 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|