Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 71530..71783 | Replicon | plasmid pKP2648-KPC |
Accession | NZ_CP072557 | ||
Organism | Klebsiella pneumoniae strain KP2648 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | J7339_RS27830 | Protein ID | WP_001312851.1 |
Coordinates | 71530..71679 (-) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 71724..71783 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
J7339_RS27795 (66889) | 66889..67304 | - | 416 | Protein_73 | IS1-like element IS1B family transposase | - |
J7339_RS27800 (67553) | 67553..67954 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
J7339_RS27805 (67887) | 67887..68144 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
J7339_RS27810 (68237) | 68237..68890 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
J7339_RS27815 (69829) | 69829..70686 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
J7339_RS29305 (70679) | 70679..70753 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
J7339_RS27825 (70998) | 70998..71246 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
J7339_RS27830 (71530) | 71530..71679 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
- (71724) | 71724..71783 | + | 60 | NuclAT_0 | - | Antitoxin |
- (71724) | 71724..71783 | + | 60 | NuclAT_0 | - | Antitoxin |
- (71724) | 71724..71783 | + | 60 | NuclAT_0 | - | Antitoxin |
- (71724) | 71724..71783 | + | 60 | NuclAT_0 | - | Antitoxin |
J7339_RS27835 (71984) | 71984..72316 | - | 333 | WP_152916585.1 | hypothetical protein | - |
J7339_RS27840 (72378) | 72378..72977 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
J7339_RS27845 (73363) | 73363..73563 | - | 201 | WP_015059022.1 | hypothetical protein | - |
J7339_RS27850 (73695) | 73695..74255 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
J7339_RS27855 (74310) | 74310..75056 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
J7339_RS27860 (75076) | 75076..75276 | - | 201 | WP_072354025.1 | hypothetical protein | - |
J7339_RS27865 (75301) | 75301..76005 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
J7339_RS27870 (76060) | 76060..76425 | - | 366 | Protein_88 | type IV conjugative transfer system protein TraE | - |
J7339_RS27875 (76445) | 76445..76750 | - | 306 | WP_004144424.1 | type IV conjugative transfer system protein TraL | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaKPC-2 / blaSHV-187 / blaCTX-M-65 | - | 1..102746 | 102746 | |
- | flank | IS/Tn | - | - | 75301..76005 | 704 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T198037 WP_001312851.1 NZ_CP072557:c71679-71530 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T198037 NZ_CP096840:c752114-751731 [Mycobacterium tuberculosis variant bovis]
TTGGCGGCTGCAACGACAACCGGAACCCACCGAGGCCTGGAACTCCGCGCTGCTCAGCGGGCCGTCGGGTCGTGCGAACC
GCAACGAGCCGAGTTCTGCCGATCAGCGCGGAATGCGGACGAGTTCGACCAGATGAGCCGGATGTTTGGTGACGTCTACC
CCGATGTGCCAGTGCCGAAATCCGTGTGGCGGTGGATCGATTCGGCACAGCACCGCCTCGCCCGGGCGGGAGCGGTGGGT
GCCCTGTCGGTTGTCGATCTGCTGATCTGCGACACTGCGGCGGCCAGGGGCCTAGTAGTCCTCCACGACGATGCCGACTA
CGAACTCGCAGAGCGTCACCTTCCCGACATCAGAGTGCGGAGGGTCGTCAGCGCCGACGACTAG
TTGGCGGCTGCAACGACAACCGGAACCCACCGAGGCCTGGAACTCCGCGCTGCTCAGCGGGCCGTCGGGTCGTGCGAACC
GCAACGAGCCGAGTTCTGCCGATCAGCGCGGAATGCGGACGAGTTCGACCAGATGAGCCGGATGTTTGGTGACGTCTACC
CCGATGTGCCAGTGCCGAAATCCGTGTGGCGGTGGATCGATTCGGCACAGCACCGCCTCGCCCGGGCGGGAGCGGTGGGT
GCCCTGTCGGTTGTCGATCTGCTGATCTGCGACACTGCGGCGGCCAGGGGCCTAGTAGTCCTCCACGACGATGCCGACTA
CGAACTCGCAGAGCGTCACCTTCCCGACATCAGAGTGCGGAGGGTCGTCAGCGCCGACGACTAG
Antitoxin
Download Length: 60 bp
>AT198037 NZ_CP072557:71724-71783 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|