Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2760519..2760739 Replicon chromosome
Accession NZ_CP072204
Organism Escherichia coli strain LWY6

Toxin (Protein)


Gene name ldrD Uniprot ID A0A8S7XT81
Locus tag J4T81_RS13340 Protein ID WP_074147554.1
Coordinates 2760632..2760739 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2760519..2760585 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
J4T81_RS13315 2755798..2757192 - 1395 WP_000086201.1 inverse autotransporter invasin YchO -
J4T81_RS13320 2757377..2757730 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
J4T81_RS13325 2757774..2758469 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
J4T81_RS13330 2758627..2758857 - 231 WP_001146442.1 putative cation transport regulator ChaB -
J4T81_RS13335 2759127..2760227 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2760519..2760585 - 67 - - Antitoxin
J4T81_RS13340 2760632..2760739 + 108 WP_074147554.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2761052..2761115 - 64 NuclAT_34 - -
- 2761052..2761115 - 64 NuclAT_34 - -
- 2761052..2761115 - 64 NuclAT_34 - -
- 2761052..2761115 - 64 NuclAT_34 - -
- 2761052..2761115 - 64 NuclAT_37 - -
- 2761052..2761115 - 64 NuclAT_37 - -
- 2761052..2761115 - 64 NuclAT_37 - -
- 2761052..2761115 - 64 NuclAT_37 - -
- 2761052..2761115 - 64 NuclAT_40 - -
- 2761052..2761115 - 64 NuclAT_40 - -
- 2761052..2761115 - 64 NuclAT_40 - -
- 2761052..2761115 - 64 NuclAT_40 - -
- 2761052..2761115 - 64 NuclAT_43 - -
- 2761052..2761115 - 64 NuclAT_43 - -
- 2761052..2761115 - 64 NuclAT_43 - -
- 2761052..2761115 - 64 NuclAT_43 - -
- 2761052..2761115 - 64 NuclAT_46 - -
- 2761052..2761115 - 64 NuclAT_46 - -
- 2761052..2761115 - 64 NuclAT_46 - -
- 2761052..2761115 - 64 NuclAT_46 - -
- 2761052..2761115 - 64 NuclAT_49 - -
- 2761052..2761115 - 64 NuclAT_49 - -
- 2761052..2761115 - 64 NuclAT_49 - -
- 2761052..2761115 - 64 NuclAT_49 - -
- 2761053..2761115 - 63 NuclAT_51 - -
- 2761053..2761115 - 63 NuclAT_51 - -
- 2761053..2761115 - 63 NuclAT_51 - -
- 2761053..2761115 - 63 NuclAT_51 - -
- 2761053..2761115 - 63 NuclAT_54 - -
- 2761053..2761115 - 63 NuclAT_54 - -
- 2761053..2761115 - 63 NuclAT_54 - -
- 2761053..2761115 - 63 NuclAT_54 - -
- 2761054..2761115 - 62 NuclAT_16 - -
- 2761054..2761115 - 62 NuclAT_16 - -
- 2761054..2761115 - 62 NuclAT_16 - -
- 2761054..2761115 - 62 NuclAT_16 - -
- 2761054..2761115 - 62 NuclAT_19 - -
- 2761054..2761115 - 62 NuclAT_19 - -
- 2761054..2761115 - 62 NuclAT_19 - -
- 2761054..2761115 - 62 NuclAT_19 - -
- 2761054..2761115 - 62 NuclAT_22 - -
- 2761054..2761115 - 62 NuclAT_22 - -
- 2761054..2761115 - 62 NuclAT_22 - -
- 2761054..2761115 - 62 NuclAT_22 - -
- 2761054..2761115 - 62 NuclAT_25 - -
- 2761054..2761115 - 62 NuclAT_25 - -
- 2761054..2761115 - 62 NuclAT_25 - -
- 2761054..2761115 - 62 NuclAT_25 - -
- 2761054..2761115 - 62 NuclAT_28 - -
- 2761054..2761115 - 62 NuclAT_28 - -
- 2761054..2761115 - 62 NuclAT_28 - -
- 2761054..2761115 - 62 NuclAT_28 - -
- 2761054..2761115 - 62 NuclAT_31 - -
- 2761054..2761115 - 62 NuclAT_31 - -
- 2761054..2761115 - 62 NuclAT_31 - -
- 2761054..2761115 - 62 NuclAT_31 - -
J4T81_RS13345 2761168..2761275 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2761588..2761653 - 66 NuclAT_33 - -
- 2761588..2761653 - 66 NuclAT_33 - -
- 2761588..2761653 - 66 NuclAT_33 - -
- 2761588..2761653 - 66 NuclAT_33 - -
- 2761588..2761653 - 66 NuclAT_36 - -
- 2761588..2761653 - 66 NuclAT_36 - -
- 2761588..2761653 - 66 NuclAT_36 - -
- 2761588..2761653 - 66 NuclAT_36 - -
- 2761588..2761653 - 66 NuclAT_39 - -
- 2761588..2761653 - 66 NuclAT_39 - -
- 2761588..2761653 - 66 NuclAT_39 - -
- 2761588..2761653 - 66 NuclAT_39 - -
- 2761588..2761653 - 66 NuclAT_42 - -
- 2761588..2761653 - 66 NuclAT_42 - -
- 2761588..2761653 - 66 NuclAT_42 - -
- 2761588..2761653 - 66 NuclAT_42 - -
- 2761588..2761653 - 66 NuclAT_45 - -
- 2761588..2761653 - 66 NuclAT_45 - -
- 2761588..2761653 - 66 NuclAT_45 - -
- 2761588..2761653 - 66 NuclAT_45 - -
- 2761588..2761653 - 66 NuclAT_48 - -
- 2761588..2761653 - 66 NuclAT_48 - -
- 2761588..2761653 - 66 NuclAT_48 - -
- 2761588..2761653 - 66 NuclAT_48 - -
- 2761589..2761655 - 67 NuclAT_50 - -
- 2761589..2761655 - 67 NuclAT_50 - -
- 2761589..2761655 - 67 NuclAT_50 - -
- 2761589..2761655 - 67 NuclAT_50 - -
- 2761589..2761655 - 67 NuclAT_53 - -
- 2761589..2761655 - 67 NuclAT_53 - -
- 2761589..2761655 - 67 NuclAT_53 - -
- 2761589..2761655 - 67 NuclAT_53 - -
- 2761590..2761653 - 64 NuclAT_15 - -
- 2761590..2761653 - 64 NuclAT_15 - -
- 2761590..2761653 - 64 NuclAT_15 - -
- 2761590..2761653 - 64 NuclAT_15 - -
- 2761590..2761653 - 64 NuclAT_18 - -
- 2761590..2761653 - 64 NuclAT_18 - -
- 2761590..2761653 - 64 NuclAT_18 - -
- 2761590..2761653 - 64 NuclAT_18 - -
- 2761590..2761653 - 64 NuclAT_21 - -
- 2761590..2761653 - 64 NuclAT_21 - -
- 2761590..2761653 - 64 NuclAT_21 - -
- 2761590..2761653 - 64 NuclAT_21 - -
- 2761590..2761653 - 64 NuclAT_24 - -
- 2761590..2761653 - 64 NuclAT_24 - -
- 2761590..2761653 - 64 NuclAT_24 - -
- 2761590..2761653 - 64 NuclAT_24 - -
- 2761590..2761653 - 64 NuclAT_27 - -
- 2761590..2761653 - 64 NuclAT_27 - -
- 2761590..2761653 - 64 NuclAT_27 - -
- 2761590..2761653 - 64 NuclAT_27 - -
- 2761590..2761653 - 64 NuclAT_30 - -
- 2761590..2761653 - 64 NuclAT_30 - -
- 2761590..2761653 - 64 NuclAT_30 - -
- 2761590..2761653 - 64 NuclAT_30 - -
J4T81_RS13350 2761703..2761810 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
J4T81_RS13355 2761959..2762813 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
J4T81_RS13360 2762849..2763658 - 810 WP_001257044.1 invasion regulator SirB1 -
J4T81_RS13365 2763662..2764054 - 393 WP_000200378.1 invasion regulator SirB2 -
J4T81_RS13370 2764051..2764884 - 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T197537 WP_074147554.1 NZ_CP072204:2760632-2760739 [Escherichia coli]
MTLAQFAMTFWHDLAAPILTGIITAAIVSWWRNRK

Download         Length: 108 bp

>T197537 NZ_CP096238:734572-735057 [Klebsiella pneumoniae subsp. pneumoniae]
ATGATCTCGGCACCAGAACCGCTTCATGCCGGGCATATTCTTACCCCGTTTTGCTGCGGTATAGATTCCATGGATCACTG
GCTGAAACAGCGGGCGATGAAAAATCAGGTTACTGGCGCATCCCGCACCTTTGTCTGCTGCGACGACGCGAAGGTGATGG
CTTACTACTCACTGGCTTCCAGCGCTGTGACGACAAATACTGCGCCGGGTCGTTTTCGCCGCAATATGCCTGACCCGATC
CCGGTTGTGGTACTGGGTCGTCTGGCGGTGGATAAATCACTACATGGGAAAGGTGTCGGGCGGGCGCTGGTACGTGATGC
CGGGCTGCGTGTGATTCAGGTGGCGGAGACTATCGGCATTCGCGGGATGCTGGTTCACGCCCTGTCGGATGAAGCACGGG
ATTTTTACCTGCGGGTGGGGTTTGAGCCGTCGCCGATGGATTCGATGATGTTGATGGTGACGTTGAGGGATTTGGTTAAT
GCCTGA

Antitoxin


Download         Length: 67 bp

>AT197537 NZ_CP072204:c2760585-2760519 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References