Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1156871..1157093 Replicon chromosome
Accession NZ_CP072054
Organism Escherichia coli strain K1508

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag J5N95_RS05615 Protein ID WP_000170963.1
Coordinates 1156871..1156978 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1157026..1157093 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
J5N95_RS05585 (1152180) 1152180..1153262 + 1083 WP_000804726.1 peptide chain release factor 1 -
J5N95_RS05590 (1153262) 1153262..1154095 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
J5N95_RS05595 (1154092) 1154092..1154484 + 393 WP_000200374.1 invasion regulator SirB2 -
J5N95_RS05600 (1154488) 1154488..1155297 + 810 WP_001257044.1 invasion regulator SirB1 -
J5N95_RS05605 (1155333) 1155333..1156187 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
J5N95_RS05610 (1156336) 1156336..1156443 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1156491) 1156491..1156557 + 67 NuclAT_34 - -
- (1156491) 1156491..1156557 + 67 NuclAT_34 - -
- (1156491) 1156491..1156557 + 67 NuclAT_34 - -
- (1156491) 1156491..1156557 + 67 NuclAT_34 - -
- (1156491) 1156491..1156557 + 67 NuclAT_36 - -
- (1156491) 1156491..1156557 + 67 NuclAT_36 - -
- (1156491) 1156491..1156557 + 67 NuclAT_36 - -
- (1156491) 1156491..1156557 + 67 NuclAT_36 - -
- (1156491) 1156491..1156557 + 67 NuclAT_38 - -
- (1156491) 1156491..1156557 + 67 NuclAT_38 - -
- (1156491) 1156491..1156557 + 67 NuclAT_38 - -
- (1156491) 1156491..1156557 + 67 NuclAT_38 - -
- (1156491) 1156491..1156557 + 67 NuclAT_40 - -
- (1156491) 1156491..1156557 + 67 NuclAT_40 - -
- (1156491) 1156491..1156557 + 67 NuclAT_40 - -
- (1156491) 1156491..1156557 + 67 NuclAT_40 - -
- (1156491) 1156491..1156557 + 67 NuclAT_42 - -
- (1156491) 1156491..1156557 + 67 NuclAT_42 - -
- (1156491) 1156491..1156557 + 67 NuclAT_42 - -
- (1156491) 1156491..1156557 + 67 NuclAT_42 - -
- (1156491) 1156491..1156557 + 67 NuclAT_44 - -
- (1156491) 1156491..1156557 + 67 NuclAT_44 - -
- (1156491) 1156491..1156557 + 67 NuclAT_44 - -
- (1156491) 1156491..1156557 + 67 NuclAT_44 - -
- (1156493) 1156493..1156558 + 66 NuclAT_18 - -
- (1156493) 1156493..1156558 + 66 NuclAT_18 - -
- (1156493) 1156493..1156558 + 66 NuclAT_18 - -
- (1156493) 1156493..1156558 + 66 NuclAT_18 - -
- (1156493) 1156493..1156558 + 66 NuclAT_21 - -
- (1156493) 1156493..1156558 + 66 NuclAT_21 - -
- (1156493) 1156493..1156558 + 66 NuclAT_21 - -
- (1156493) 1156493..1156558 + 66 NuclAT_21 - -
- (1156493) 1156493..1156558 + 66 NuclAT_24 - -
- (1156493) 1156493..1156558 + 66 NuclAT_24 - -
- (1156493) 1156493..1156558 + 66 NuclAT_24 - -
- (1156493) 1156493..1156558 + 66 NuclAT_24 - -
- (1156493) 1156493..1156558 + 66 NuclAT_27 - -
- (1156493) 1156493..1156558 + 66 NuclAT_27 - -
- (1156493) 1156493..1156558 + 66 NuclAT_27 - -
- (1156493) 1156493..1156558 + 66 NuclAT_27 - -
- (1156493) 1156493..1156558 + 66 NuclAT_30 - -
- (1156493) 1156493..1156558 + 66 NuclAT_30 - -
- (1156493) 1156493..1156558 + 66 NuclAT_30 - -
- (1156493) 1156493..1156558 + 66 NuclAT_30 - -
- (1156493) 1156493..1156558 + 66 NuclAT_33 - -
- (1156493) 1156493..1156558 + 66 NuclAT_33 - -
- (1156493) 1156493..1156558 + 66 NuclAT_33 - -
- (1156493) 1156493..1156558 + 66 NuclAT_33 - -
J5N95_RS05615 (1156871) 1156871..1156978 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1157027) 1157027..1157092 + 66 NuclAT_35 - -
- (1157027) 1157027..1157092 + 66 NuclAT_35 - -
- (1157027) 1157027..1157092 + 66 NuclAT_35 - -
- (1157027) 1157027..1157092 + 66 NuclAT_35 - -
- (1157027) 1157027..1157092 + 66 NuclAT_37 - -
- (1157027) 1157027..1157092 + 66 NuclAT_37 - -
- (1157027) 1157027..1157092 + 66 NuclAT_37 - -
- (1157027) 1157027..1157092 + 66 NuclAT_37 - -
- (1157027) 1157027..1157092 + 66 NuclAT_39 - -
- (1157027) 1157027..1157092 + 66 NuclAT_39 - -
- (1157027) 1157027..1157092 + 66 NuclAT_39 - -
- (1157027) 1157027..1157092 + 66 NuclAT_39 - -
- (1157027) 1157027..1157092 + 66 NuclAT_41 - -
- (1157027) 1157027..1157092 + 66 NuclAT_41 - -
- (1157027) 1157027..1157092 + 66 NuclAT_41 - -
- (1157027) 1157027..1157092 + 66 NuclAT_41 - -
- (1157027) 1157027..1157092 + 66 NuclAT_43 - -
- (1157027) 1157027..1157092 + 66 NuclAT_43 - -
- (1157027) 1157027..1157092 + 66 NuclAT_43 - -
- (1157027) 1157027..1157092 + 66 NuclAT_43 - -
- (1157027) 1157027..1157092 + 66 NuclAT_45 - -
- (1157027) 1157027..1157092 + 66 NuclAT_45 - -
- (1157027) 1157027..1157092 + 66 NuclAT_45 - -
- (1157027) 1157027..1157092 + 66 NuclAT_45 - -
- (1157026) 1157026..1157093 + 68 NuclAT_17 - Antitoxin
- (1157026) 1157026..1157093 + 68 NuclAT_17 - Antitoxin
- (1157026) 1157026..1157093 + 68 NuclAT_17 - Antitoxin
- (1157026) 1157026..1157093 + 68 NuclAT_17 - Antitoxin
- (1157026) 1157026..1157093 + 68 NuclAT_20 - Antitoxin
- (1157026) 1157026..1157093 + 68 NuclAT_20 - Antitoxin
- (1157026) 1157026..1157093 + 68 NuclAT_20 - Antitoxin
- (1157026) 1157026..1157093 + 68 NuclAT_20 - Antitoxin
- (1157026) 1157026..1157093 + 68 NuclAT_23 - Antitoxin
- (1157026) 1157026..1157093 + 68 NuclAT_23 - Antitoxin
- (1157026) 1157026..1157093 + 68 NuclAT_23 - Antitoxin
- (1157026) 1157026..1157093 + 68 NuclAT_23 - Antitoxin
- (1157026) 1157026..1157093 + 68 NuclAT_26 - Antitoxin
- (1157026) 1157026..1157093 + 68 NuclAT_26 - Antitoxin
- (1157026) 1157026..1157093 + 68 NuclAT_26 - Antitoxin
- (1157026) 1157026..1157093 + 68 NuclAT_26 - Antitoxin
- (1157026) 1157026..1157093 + 68 NuclAT_29 - Antitoxin
- (1157026) 1157026..1157093 + 68 NuclAT_29 - Antitoxin
- (1157026) 1157026..1157093 + 68 NuclAT_29 - Antitoxin
- (1157026) 1157026..1157093 + 68 NuclAT_29 - Antitoxin
- (1157026) 1157026..1157093 + 68 NuclAT_32 - Antitoxin
- (1157026) 1157026..1157093 + 68 NuclAT_32 - Antitoxin
- (1157026) 1157026..1157093 + 68 NuclAT_32 - Antitoxin
- (1157026) 1157026..1157093 + 68 NuclAT_32 - Antitoxin
J5N95_RS05620 (1157406) 1157406..1157513 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1157561) 1157561..1157628 + 68 NuclAT_16 - -
- (1157561) 1157561..1157628 + 68 NuclAT_16 - -
- (1157561) 1157561..1157628 + 68 NuclAT_16 - -
- (1157561) 1157561..1157628 + 68 NuclAT_16 - -
- (1157561) 1157561..1157628 + 68 NuclAT_19 - -
- (1157561) 1157561..1157628 + 68 NuclAT_19 - -
- (1157561) 1157561..1157628 + 68 NuclAT_19 - -
- (1157561) 1157561..1157628 + 68 NuclAT_19 - -
- (1157561) 1157561..1157628 + 68 NuclAT_22 - -
- (1157561) 1157561..1157628 + 68 NuclAT_22 - -
- (1157561) 1157561..1157628 + 68 NuclAT_22 - -
- (1157561) 1157561..1157628 + 68 NuclAT_22 - -
- (1157561) 1157561..1157628 + 68 NuclAT_25 - -
- (1157561) 1157561..1157628 + 68 NuclAT_25 - -
- (1157561) 1157561..1157628 + 68 NuclAT_25 - -
- (1157561) 1157561..1157628 + 68 NuclAT_25 - -
- (1157561) 1157561..1157628 + 68 NuclAT_28 - -
- (1157561) 1157561..1157628 + 68 NuclAT_28 - -
- (1157561) 1157561..1157628 + 68 NuclAT_28 - -
- (1157561) 1157561..1157628 + 68 NuclAT_28 - -
- (1157561) 1157561..1157628 + 68 NuclAT_31 - -
- (1157561) 1157561..1157628 + 68 NuclAT_31 - -
- (1157561) 1157561..1157628 + 68 NuclAT_31 - -
- (1157561) 1157561..1157628 + 68 NuclAT_31 - -
J5N95_RS05625 (1157917) 1157917..1159017 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
J5N95_RS05630 (1159287) 1159287..1159517 + 231 WP_001146444.1 putative cation transport regulator ChaB -
J5N95_RS05635 (1159675) 1159675..1160370 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
J5N95_RS05640 (1160414) 1160414..1160767 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T197247 WP_000170963.1 NZ_CP072054:c1156978-1156871 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T197247 NZ_CP095843:c3570602-3570138 [Escherichia fergusonii]
ATGGATTTTCCACAAAGGGTTAATGGTTGGGCGCTATATGCTCATCCCTGTTTTCAGGAAACCTACGACGCTTTAGTTGC
CGAAGTCGAGACATTAAAGGGAAAAGATCCTGAAAATTATCAGAGAAAAGCCGCCACAAAGTTATTGGCGGTAGTCCATA
AAGTGATTGAGGAGCATATCACGGTCAATCCATCATCACCGGCATTCCGTCATGGCAAGTCGTTAGGCTCTGGGAAAAAT
AAAGACTGGTCACGGGTAAAATTTGGTGCTGGTCGTTATCGTCTCTTCTTTCGTTACAGCGAAAAAGAGAAAGTCATCAT
TCTGGGATGGATGAACGATGAAAACACTCTGCGCACCTACGGTAAAAAAACAGATGCCTATACCGTATTCAGCAAAATGT
TAAAAAGAGGACATCCTCCTGCCGACTGGGAAACCCTCACCCGAGAGACAGAAGAAGCCCATTGA

Antitoxin


Download         Length: 68 bp

>AT197247 NZ_CP072054:1157026-1157093 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure


Antitoxin

Download structure file

References