Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1156871..1157093 | Replicon | chromosome |
| Accession | NZ_CP072054 | ||
| Organism | Escherichia coli strain K1508 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | J7R083 |
| Locus tag | J5N95_RS05615 | Protein ID | WP_000170963.1 |
| Coordinates | 1156871..1156978 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1157026..1157093 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| J5N95_RS05585 (1152180) | 1152180..1153262 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| J5N95_RS05590 (1153262) | 1153262..1154095 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| J5N95_RS05595 (1154092) | 1154092..1154484 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| J5N95_RS05600 (1154488) | 1154488..1155297 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| J5N95_RS05605 (1155333) | 1155333..1156187 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| J5N95_RS05610 (1156336) | 1156336..1156443 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1156491) | 1156491..1156557 | + | 67 | NuclAT_34 | - | - |
| - (1156491) | 1156491..1156557 | + | 67 | NuclAT_34 | - | - |
| - (1156491) | 1156491..1156557 | + | 67 | NuclAT_34 | - | - |
| - (1156491) | 1156491..1156557 | + | 67 | NuclAT_34 | - | - |
| - (1156491) | 1156491..1156557 | + | 67 | NuclAT_36 | - | - |
| - (1156491) | 1156491..1156557 | + | 67 | NuclAT_36 | - | - |
| - (1156491) | 1156491..1156557 | + | 67 | NuclAT_36 | - | - |
| - (1156491) | 1156491..1156557 | + | 67 | NuclAT_36 | - | - |
| - (1156491) | 1156491..1156557 | + | 67 | NuclAT_38 | - | - |
| - (1156491) | 1156491..1156557 | + | 67 | NuclAT_38 | - | - |
| - (1156491) | 1156491..1156557 | + | 67 | NuclAT_38 | - | - |
| - (1156491) | 1156491..1156557 | + | 67 | NuclAT_38 | - | - |
| - (1156491) | 1156491..1156557 | + | 67 | NuclAT_40 | - | - |
| - (1156491) | 1156491..1156557 | + | 67 | NuclAT_40 | - | - |
| - (1156491) | 1156491..1156557 | + | 67 | NuclAT_40 | - | - |
| - (1156491) | 1156491..1156557 | + | 67 | NuclAT_40 | - | - |
| - (1156491) | 1156491..1156557 | + | 67 | NuclAT_42 | - | - |
| - (1156491) | 1156491..1156557 | + | 67 | NuclAT_42 | - | - |
| - (1156491) | 1156491..1156557 | + | 67 | NuclAT_42 | - | - |
| - (1156491) | 1156491..1156557 | + | 67 | NuclAT_42 | - | - |
| - (1156491) | 1156491..1156557 | + | 67 | NuclAT_44 | - | - |
| - (1156491) | 1156491..1156557 | + | 67 | NuclAT_44 | - | - |
| - (1156491) | 1156491..1156557 | + | 67 | NuclAT_44 | - | - |
| - (1156491) | 1156491..1156557 | + | 67 | NuclAT_44 | - | - |
| - (1156493) | 1156493..1156558 | + | 66 | NuclAT_18 | - | - |
| - (1156493) | 1156493..1156558 | + | 66 | NuclAT_18 | - | - |
| - (1156493) | 1156493..1156558 | + | 66 | NuclAT_18 | - | - |
| - (1156493) | 1156493..1156558 | + | 66 | NuclAT_18 | - | - |
| - (1156493) | 1156493..1156558 | + | 66 | NuclAT_21 | - | - |
| - (1156493) | 1156493..1156558 | + | 66 | NuclAT_21 | - | - |
| - (1156493) | 1156493..1156558 | + | 66 | NuclAT_21 | - | - |
| - (1156493) | 1156493..1156558 | + | 66 | NuclAT_21 | - | - |
| - (1156493) | 1156493..1156558 | + | 66 | NuclAT_24 | - | - |
| - (1156493) | 1156493..1156558 | + | 66 | NuclAT_24 | - | - |
| - (1156493) | 1156493..1156558 | + | 66 | NuclAT_24 | - | - |
| - (1156493) | 1156493..1156558 | + | 66 | NuclAT_24 | - | - |
| - (1156493) | 1156493..1156558 | + | 66 | NuclAT_27 | - | - |
| - (1156493) | 1156493..1156558 | + | 66 | NuclAT_27 | - | - |
| - (1156493) | 1156493..1156558 | + | 66 | NuclAT_27 | - | - |
| - (1156493) | 1156493..1156558 | + | 66 | NuclAT_27 | - | - |
| - (1156493) | 1156493..1156558 | + | 66 | NuclAT_30 | - | - |
| - (1156493) | 1156493..1156558 | + | 66 | NuclAT_30 | - | - |
| - (1156493) | 1156493..1156558 | + | 66 | NuclAT_30 | - | - |
| - (1156493) | 1156493..1156558 | + | 66 | NuclAT_30 | - | - |
| - (1156493) | 1156493..1156558 | + | 66 | NuclAT_33 | - | - |
| - (1156493) | 1156493..1156558 | + | 66 | NuclAT_33 | - | - |
| - (1156493) | 1156493..1156558 | + | 66 | NuclAT_33 | - | - |
| - (1156493) | 1156493..1156558 | + | 66 | NuclAT_33 | - | - |
| J5N95_RS05615 (1156871) | 1156871..1156978 | - | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (1157027) | 1157027..1157092 | + | 66 | NuclAT_35 | - | - |
| - (1157027) | 1157027..1157092 | + | 66 | NuclAT_35 | - | - |
| - (1157027) | 1157027..1157092 | + | 66 | NuclAT_35 | - | - |
| - (1157027) | 1157027..1157092 | + | 66 | NuclAT_35 | - | - |
| - (1157027) | 1157027..1157092 | + | 66 | NuclAT_37 | - | - |
| - (1157027) | 1157027..1157092 | + | 66 | NuclAT_37 | - | - |
| - (1157027) | 1157027..1157092 | + | 66 | NuclAT_37 | - | - |
| - (1157027) | 1157027..1157092 | + | 66 | NuclAT_37 | - | - |
| - (1157027) | 1157027..1157092 | + | 66 | NuclAT_39 | - | - |
| - (1157027) | 1157027..1157092 | + | 66 | NuclAT_39 | - | - |
| - (1157027) | 1157027..1157092 | + | 66 | NuclAT_39 | - | - |
| - (1157027) | 1157027..1157092 | + | 66 | NuclAT_39 | - | - |
| - (1157027) | 1157027..1157092 | + | 66 | NuclAT_41 | - | - |
| - (1157027) | 1157027..1157092 | + | 66 | NuclAT_41 | - | - |
| - (1157027) | 1157027..1157092 | + | 66 | NuclAT_41 | - | - |
| - (1157027) | 1157027..1157092 | + | 66 | NuclAT_41 | - | - |
| - (1157027) | 1157027..1157092 | + | 66 | NuclAT_43 | - | - |
| - (1157027) | 1157027..1157092 | + | 66 | NuclAT_43 | - | - |
| - (1157027) | 1157027..1157092 | + | 66 | NuclAT_43 | - | - |
| - (1157027) | 1157027..1157092 | + | 66 | NuclAT_43 | - | - |
| - (1157027) | 1157027..1157092 | + | 66 | NuclAT_45 | - | - |
| - (1157027) | 1157027..1157092 | + | 66 | NuclAT_45 | - | - |
| - (1157027) | 1157027..1157092 | + | 66 | NuclAT_45 | - | - |
| - (1157027) | 1157027..1157092 | + | 66 | NuclAT_45 | - | - |
| - (1157026) | 1157026..1157093 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (1157026) | 1157026..1157093 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (1157026) | 1157026..1157093 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (1157026) | 1157026..1157093 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (1157026) | 1157026..1157093 | + | 68 | NuclAT_20 | - | Antitoxin |
| - (1157026) | 1157026..1157093 | + | 68 | NuclAT_20 | - | Antitoxin |
| - (1157026) | 1157026..1157093 | + | 68 | NuclAT_20 | - | Antitoxin |
| - (1157026) | 1157026..1157093 | + | 68 | NuclAT_20 | - | Antitoxin |
| - (1157026) | 1157026..1157093 | + | 68 | NuclAT_23 | - | Antitoxin |
| - (1157026) | 1157026..1157093 | + | 68 | NuclAT_23 | - | Antitoxin |
| - (1157026) | 1157026..1157093 | + | 68 | NuclAT_23 | - | Antitoxin |
| - (1157026) | 1157026..1157093 | + | 68 | NuclAT_23 | - | Antitoxin |
| - (1157026) | 1157026..1157093 | + | 68 | NuclAT_26 | - | Antitoxin |
| - (1157026) | 1157026..1157093 | + | 68 | NuclAT_26 | - | Antitoxin |
| - (1157026) | 1157026..1157093 | + | 68 | NuclAT_26 | - | Antitoxin |
| - (1157026) | 1157026..1157093 | + | 68 | NuclAT_26 | - | Antitoxin |
| - (1157026) | 1157026..1157093 | + | 68 | NuclAT_29 | - | Antitoxin |
| - (1157026) | 1157026..1157093 | + | 68 | NuclAT_29 | - | Antitoxin |
| - (1157026) | 1157026..1157093 | + | 68 | NuclAT_29 | - | Antitoxin |
| - (1157026) | 1157026..1157093 | + | 68 | NuclAT_29 | - | Antitoxin |
| - (1157026) | 1157026..1157093 | + | 68 | NuclAT_32 | - | Antitoxin |
| - (1157026) | 1157026..1157093 | + | 68 | NuclAT_32 | - | Antitoxin |
| - (1157026) | 1157026..1157093 | + | 68 | NuclAT_32 | - | Antitoxin |
| - (1157026) | 1157026..1157093 | + | 68 | NuclAT_32 | - | Antitoxin |
| J5N95_RS05620 (1157406) | 1157406..1157513 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1157561) | 1157561..1157628 | + | 68 | NuclAT_16 | - | - |
| - (1157561) | 1157561..1157628 | + | 68 | NuclAT_16 | - | - |
| - (1157561) | 1157561..1157628 | + | 68 | NuclAT_16 | - | - |
| - (1157561) | 1157561..1157628 | + | 68 | NuclAT_16 | - | - |
| - (1157561) | 1157561..1157628 | + | 68 | NuclAT_19 | - | - |
| - (1157561) | 1157561..1157628 | + | 68 | NuclAT_19 | - | - |
| - (1157561) | 1157561..1157628 | + | 68 | NuclAT_19 | - | - |
| - (1157561) | 1157561..1157628 | + | 68 | NuclAT_19 | - | - |
| - (1157561) | 1157561..1157628 | + | 68 | NuclAT_22 | - | - |
| - (1157561) | 1157561..1157628 | + | 68 | NuclAT_22 | - | - |
| - (1157561) | 1157561..1157628 | + | 68 | NuclAT_22 | - | - |
| - (1157561) | 1157561..1157628 | + | 68 | NuclAT_22 | - | - |
| - (1157561) | 1157561..1157628 | + | 68 | NuclAT_25 | - | - |
| - (1157561) | 1157561..1157628 | + | 68 | NuclAT_25 | - | - |
| - (1157561) | 1157561..1157628 | + | 68 | NuclAT_25 | - | - |
| - (1157561) | 1157561..1157628 | + | 68 | NuclAT_25 | - | - |
| - (1157561) | 1157561..1157628 | + | 68 | NuclAT_28 | - | - |
| - (1157561) | 1157561..1157628 | + | 68 | NuclAT_28 | - | - |
| - (1157561) | 1157561..1157628 | + | 68 | NuclAT_28 | - | - |
| - (1157561) | 1157561..1157628 | + | 68 | NuclAT_28 | - | - |
| - (1157561) | 1157561..1157628 | + | 68 | NuclAT_31 | - | - |
| - (1157561) | 1157561..1157628 | + | 68 | NuclAT_31 | - | - |
| - (1157561) | 1157561..1157628 | + | 68 | NuclAT_31 | - | - |
| - (1157561) | 1157561..1157628 | + | 68 | NuclAT_31 | - | - |
| J5N95_RS05625 (1157917) | 1157917..1159017 | - | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
| J5N95_RS05630 (1159287) | 1159287..1159517 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| J5N95_RS05635 (1159675) | 1159675..1160370 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| J5N95_RS05640 (1160414) | 1160414..1160767 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T197247 WP_000170963.1 NZ_CP072054:c1156978-1156871 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T197247 NZ_CP095843:c3570602-3570138 [Escherichia fergusonii]
ATGGATTTTCCACAAAGGGTTAATGGTTGGGCGCTATATGCTCATCCCTGTTTTCAGGAAACCTACGACGCTTTAGTTGC
CGAAGTCGAGACATTAAAGGGAAAAGATCCTGAAAATTATCAGAGAAAAGCCGCCACAAAGTTATTGGCGGTAGTCCATA
AAGTGATTGAGGAGCATATCACGGTCAATCCATCATCACCGGCATTCCGTCATGGCAAGTCGTTAGGCTCTGGGAAAAAT
AAAGACTGGTCACGGGTAAAATTTGGTGCTGGTCGTTATCGTCTCTTCTTTCGTTACAGCGAAAAAGAGAAAGTCATCAT
TCTGGGATGGATGAACGATGAAAACACTCTGCGCACCTACGGTAAAAAAACAGATGCCTATACCGTATTCAGCAAAATGT
TAAAAAGAGGACATCCTCCTGCCGACTGGGAAACCCTCACCCGAGAGACAGAAGAAGCCCATTGA
ATGGATTTTCCACAAAGGGTTAATGGTTGGGCGCTATATGCTCATCCCTGTTTTCAGGAAACCTACGACGCTTTAGTTGC
CGAAGTCGAGACATTAAAGGGAAAAGATCCTGAAAATTATCAGAGAAAAGCCGCCACAAAGTTATTGGCGGTAGTCCATA
AAGTGATTGAGGAGCATATCACGGTCAATCCATCATCACCGGCATTCCGTCATGGCAAGTCGTTAGGCTCTGGGAAAAAT
AAAGACTGGTCACGGGTAAAATTTGGTGCTGGTCGTTATCGTCTCTTCTTTCGTTACAGCGAAAAAGAGAAAGTCATCAT
TCTGGGATGGATGAACGATGAAAACACTCTGCGCACCTACGGTAAAAAAACAGATGCCTATACCGTATTCAGCAAAATGT
TAAAAAGAGGACATCCTCCTGCCGACTGGGAAACCCTCACCCGAGAGACAGAAGAAGCCCATTGA
Antitoxin
Download Length: 68 bp
>AT197247 NZ_CP072054:1157026-1157093 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|