Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 426345..426565 Replicon chromosome
Accession NZ_CP071711
Organism Escherichia coli strain EC20017429

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag JQM62_RS02110 Protein ID WP_000170965.1
Coordinates 426458..426565 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 426345..426411 (-)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JQM62_RS02085 421624..423018 - 1395 WP_000086212.1 inverse autotransporter invasin YchO -
JQM62_RS02090 423203..423556 + 354 WP_001169666.1 DsrE/F sulfur relay family protein YchN -
JQM62_RS02095 423600..424295 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
JQM62_RS02100 424453..424683 - 231 WP_001146442.1 putative cation transport regulator ChaB -
JQM62_RS02105 424953..426053 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 426345..426411 - 67 - - Antitoxin
JQM62_RS02110 426458..426565 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 426878..426941 - 64 NuclAT_33 - -
- 426878..426941 - 64 NuclAT_33 - -
- 426878..426941 - 64 NuclAT_33 - -
- 426878..426941 - 64 NuclAT_33 - -
- 426878..426941 - 64 NuclAT_35 - -
- 426878..426941 - 64 NuclAT_35 - -
- 426878..426941 - 64 NuclAT_35 - -
- 426878..426941 - 64 NuclAT_35 - -
- 426878..426941 - 64 NuclAT_37 - -
- 426878..426941 - 64 NuclAT_37 - -
- 426878..426941 - 64 NuclAT_37 - -
- 426878..426941 - 64 NuclAT_37 - -
- 426878..426941 - 64 NuclAT_39 - -
- 426878..426941 - 64 NuclAT_39 - -
- 426878..426941 - 64 NuclAT_39 - -
- 426878..426941 - 64 NuclAT_39 - -
- 426878..426941 - 64 NuclAT_41 - -
- 426878..426941 - 64 NuclAT_41 - -
- 426878..426941 - 64 NuclAT_41 - -
- 426878..426941 - 64 NuclAT_41 - -
- 426878..426941 - 64 NuclAT_43 - -
- 426878..426941 - 64 NuclAT_43 - -
- 426878..426941 - 64 NuclAT_43 - -
- 426878..426941 - 64 NuclAT_43 - -
- 426879..426941 - 63 NuclAT_45 - -
- 426879..426941 - 63 NuclAT_45 - -
- 426879..426941 - 63 NuclAT_45 - -
- 426879..426941 - 63 NuclAT_45 - -
- 426879..426941 - 63 NuclAT_48 - -
- 426879..426941 - 63 NuclAT_48 - -
- 426879..426941 - 63 NuclAT_48 - -
- 426879..426941 - 63 NuclAT_48 - -
- 426880..426941 - 62 NuclAT_15 - -
- 426880..426941 - 62 NuclAT_15 - -
- 426880..426941 - 62 NuclAT_15 - -
- 426880..426941 - 62 NuclAT_15 - -
- 426880..426941 - 62 NuclAT_18 - -
- 426880..426941 - 62 NuclAT_18 - -
- 426880..426941 - 62 NuclAT_18 - -
- 426880..426941 - 62 NuclAT_18 - -
- 426880..426941 - 62 NuclAT_21 - -
- 426880..426941 - 62 NuclAT_21 - -
- 426880..426941 - 62 NuclAT_21 - -
- 426880..426941 - 62 NuclAT_21 - -
- 426880..426941 - 62 NuclAT_24 - -
- 426880..426941 - 62 NuclAT_24 - -
- 426880..426941 - 62 NuclAT_24 - -
- 426880..426941 - 62 NuclAT_24 - -
- 426880..426941 - 62 NuclAT_27 - -
- 426880..426941 - 62 NuclAT_27 - -
- 426880..426941 - 62 NuclAT_27 - -
- 426880..426941 - 62 NuclAT_27 - -
- 426880..426941 - 62 NuclAT_30 - -
- 426880..426941 - 62 NuclAT_30 - -
- 426880..426941 - 62 NuclAT_30 - -
- 426880..426941 - 62 NuclAT_30 - -
JQM62_RS02115 426994..427101 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 427415..427481 - 67 NuclAT_44 - -
- 427415..427481 - 67 NuclAT_44 - -
- 427415..427481 - 67 NuclAT_44 - -
- 427415..427481 - 67 NuclAT_44 - -
- 427415..427481 - 67 NuclAT_47 - -
- 427415..427481 - 67 NuclAT_47 - -
- 427415..427481 - 67 NuclAT_47 - -
- 427415..427481 - 67 NuclAT_47 - -
- 427416..427479 - 64 NuclAT_16 - -
- 427416..427479 - 64 NuclAT_16 - -
- 427416..427479 - 64 NuclAT_16 - -
- 427416..427479 - 64 NuclAT_16 - -
- 427416..427479 - 64 NuclAT_19 - -
- 427416..427479 - 64 NuclAT_19 - -
- 427416..427479 - 64 NuclAT_19 - -
- 427416..427479 - 64 NuclAT_19 - -
- 427416..427479 - 64 NuclAT_22 - -
- 427416..427479 - 64 NuclAT_22 - -
- 427416..427479 - 64 NuclAT_22 - -
- 427416..427479 - 64 NuclAT_22 - -
- 427416..427479 - 64 NuclAT_25 - -
- 427416..427479 - 64 NuclAT_25 - -
- 427416..427479 - 64 NuclAT_25 - -
- 427416..427479 - 64 NuclAT_25 - -
- 427416..427479 - 64 NuclAT_28 - -
- 427416..427479 - 64 NuclAT_28 - -
- 427416..427479 - 64 NuclAT_28 - -
- 427416..427479 - 64 NuclAT_28 - -
- 427416..427479 - 64 NuclAT_31 - -
- 427416..427479 - 64 NuclAT_31 - -
- 427416..427479 - 64 NuclAT_31 - -
- 427416..427479 - 64 NuclAT_31 - -
JQM62_RS02120 427529..427636 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
JQM62_RS02125 427785..428639 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
JQM62_RS02130 428675..429484 - 810 WP_001257037.1 invasion regulator SirB1 -
JQM62_RS02135 429488..429880 - 393 WP_000200392.1 invasion regulator SirB2 -
JQM62_RS02140 429877..430710 - 834 WP_000456459.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T196754 WP_000170965.1 NZ_CP071711:426458-426565 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T196754 NZ_CP095377:2274049-2274786 [Bacillus cereus]
ATGATCTCTAACATTCGAATTGGCTTATTTGTTTTAGCGATTGTCTTTGTAGTCCTTGTTTTCTTTTATTGGAAAAATGA
AGAGTTGTACGAGGAGAAGAAGCAACGTATTAGAAAGACTTGGTATGGTTTGTTTATCATATCTGTCACCGTGTATTTCA
TGATAAAAGGAATCGATTTAACCCTCTGGAAAAATCTTTTAATGTTTACTGCAATGGTTATTTTTGTTGATATTGCGTTC
ATTTTAACGCCTAATATTTCAGAAATATGGGGTGCAAAATTTAGCGATATTGGCAAGACAGTTCAATCCATAAAACGATC
ATTAATTGCATCTAAAGCAAGAGGAGAAATATACACGACAATTATTCAAAATGTTAATCCAGCAGTATTCGGTACGATGG
AATGGCATACGGAAGAGGAATATACAAAGAGCTTAAATGCATTTTTAGATTCATATGGGGAAAAGATTGGCGCGAAAATT
GTTGTTTTTGAAGCTGCGAAGGAATTAAATACAAACTTTCGTGGTATTCGCTCACAATTTAGTATTATCGTCCCGTTAGA
ACATATCGAGCAATTGAATGAGCAGAAAGCGGTGCAAGTAGAAAATGTCGGGATTATACCAGCAAAAATAGTAAGTGACG
TTTTCATTGTTATTGATGGAAAGAAAAATAACCTGCAAGATCGGGATTTTGAAAATGTATATAATTTAACAATACATCAT
AGTTATTTTAGTAAATAA

Antitoxin


Download         Length: 67 bp

>AT196754 NZ_CP071711:c426411-426345 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029


Antitoxin

Download structure file

References