Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2332095..2332394 | Replicon | chromosome |
| Accession | NZ_CP071594 | ||
| Organism | Staphylococcus aureus strain PNID0137 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | J3R87_RS11275 | Protein ID | WP_011447039.1 |
| Coordinates | 2332218..2332394 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2332095..2332152 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| J3R87_RS11240 | 2327567..2328472 | - | 906 | WP_000913238.1 | DUF1672 domain-containing protein | - |
| J3R87_RS11245 | 2328562..2328777 | - | 216 | WP_170267452.1 | hypothetical protein | - |
| J3R87_RS11250 | 2328982..2329719 | - | 738 | WP_000278830.1 | hypothetical protein | - |
| J3R87_RS11255 | 2329726..2330520 | - | 795 | WP_000238963.1 | phosphatidylinositol kinase | - |
| J3R87_RS11260 | 2330985..2331740 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| J3R87_RS11265 | 2331752..2332006 | - | 255 | WP_000611512.1 | phage holin | - |
| J3R87_RS11270 | 2332058..2332165 | + | 108 | WP_031790389.1 | hypothetical protein | - |
| - | 2332087..2332226 | + | 140 | NuclAT_0 | - | - |
| - | 2332087..2332226 | + | 140 | NuclAT_0 | - | - |
| - | 2332087..2332226 | + | 140 | NuclAT_0 | - | - |
| - | 2332087..2332226 | + | 140 | NuclAT_0 | - | - |
| - | 2332095..2332152 | + | 58 | - | - | Antitoxin |
| J3R87_RS11275 | 2332218..2332394 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| J3R87_RS11280 | 2332544..2332840 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| J3R87_RS11285 | 2332898..2333185 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| J3R87_RS11290 | 2333232..2333384 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| J3R87_RS11295 | 2333374..2337159 | - | 3786 | WP_073392894.1 | phage tail spike protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ebp | 2321011..2380992 | 59981 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T196591 WP_011447039.1 NZ_CP071594:c2332394-2332218 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T196591 NZ_CP095170:c2943045-2942942 [Enterobacter roggenkampii]
GGCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
GGCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 58 bp
>AT196591 NZ_CP071594:2332095-2332152 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|