Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 330618..330838 Replicon chromosome
Accession NZ_CP071441
Organism Escherichia coli strain EcPF20

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag J1F34_RS01655 Protein ID WP_000170965.1
Coordinates 330618..330725 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 330772..330838 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
J1F34_RS01625 326473..327306 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
J1F34_RS01630 327303..327695 + 393 WP_000200392.1 invasion regulator SirB2 -
J1F34_RS01635 327699..328508 + 810 WP_001257044.1 invasion regulator SirB1 -
J1F34_RS01640 328544..329398 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
J1F34_RS01645 329547..329654 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 329702..329768 + 67 NuclAT_49 - -
- 329702..329768 + 67 NuclAT_49 - -
- 329702..329768 + 67 NuclAT_49 - -
- 329702..329768 + 67 NuclAT_49 - -
- 329702..329768 + 67 NuclAT_52 - -
- 329702..329768 + 67 NuclAT_52 - -
- 329702..329768 + 67 NuclAT_52 - -
- 329702..329768 + 67 NuclAT_52 - -
- 329702..329768 + 67 NuclAT_55 - -
- 329702..329768 + 67 NuclAT_55 - -
- 329702..329768 + 67 NuclAT_55 - -
- 329702..329768 + 67 NuclAT_55 - -
- 329704..329767 + 64 NuclAT_14 - -
- 329704..329767 + 64 NuclAT_14 - -
- 329704..329767 + 64 NuclAT_14 - -
- 329704..329767 + 64 NuclAT_14 - -
- 329704..329767 + 64 NuclAT_17 - -
- 329704..329767 + 64 NuclAT_17 - -
- 329704..329767 + 64 NuclAT_17 - -
- 329704..329767 + 64 NuclAT_17 - -
- 329704..329767 + 64 NuclAT_20 - -
- 329704..329767 + 64 NuclAT_20 - -
- 329704..329767 + 64 NuclAT_20 - -
- 329704..329767 + 64 NuclAT_20 - -
- 329704..329767 + 64 NuclAT_23 - -
- 329704..329767 + 64 NuclAT_23 - -
- 329704..329767 + 64 NuclAT_23 - -
- 329704..329767 + 64 NuclAT_23 - -
- 329704..329767 + 64 NuclAT_26 - -
- 329704..329767 + 64 NuclAT_26 - -
- 329704..329767 + 64 NuclAT_26 - -
- 329704..329767 + 64 NuclAT_26 - -
- 329704..329767 + 64 NuclAT_29 - -
- 329704..329767 + 64 NuclAT_29 - -
- 329704..329767 + 64 NuclAT_29 - -
- 329704..329767 + 64 NuclAT_29 - -
- 329704..329769 + 66 NuclAT_32 - -
- 329704..329769 + 66 NuclAT_32 - -
- 329704..329769 + 66 NuclAT_32 - -
- 329704..329769 + 66 NuclAT_32 - -
- 329704..329769 + 66 NuclAT_35 - -
- 329704..329769 + 66 NuclAT_35 - -
- 329704..329769 + 66 NuclAT_35 - -
- 329704..329769 + 66 NuclAT_35 - -
- 329704..329769 + 66 NuclAT_38 - -
- 329704..329769 + 66 NuclAT_38 - -
- 329704..329769 + 66 NuclAT_38 - -
- 329704..329769 + 66 NuclAT_38 - -
- 329704..329769 + 66 NuclAT_41 - -
- 329704..329769 + 66 NuclAT_41 - -
- 329704..329769 + 66 NuclAT_41 - -
- 329704..329769 + 66 NuclAT_41 - -
- 329704..329769 + 66 NuclAT_44 - -
- 329704..329769 + 66 NuclAT_44 - -
- 329704..329769 + 66 NuclAT_44 - -
- 329704..329769 + 66 NuclAT_44 - -
- 329704..329769 + 66 NuclAT_47 - -
- 329704..329769 + 66 NuclAT_47 - -
- 329704..329769 + 66 NuclAT_47 - -
- 329704..329769 + 66 NuclAT_47 - -
J1F34_RS01650 330082..330189 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 330242..330303 + 62 NuclAT_15 - -
- 330242..330303 + 62 NuclAT_15 - -
- 330242..330303 + 62 NuclAT_15 - -
- 330242..330303 + 62 NuclAT_15 - -
- 330242..330303 + 62 NuclAT_18 - -
- 330242..330303 + 62 NuclAT_18 - -
- 330242..330303 + 62 NuclAT_18 - -
- 330242..330303 + 62 NuclAT_18 - -
- 330242..330303 + 62 NuclAT_21 - -
- 330242..330303 + 62 NuclAT_21 - -
- 330242..330303 + 62 NuclAT_21 - -
- 330242..330303 + 62 NuclAT_21 - -
- 330242..330303 + 62 NuclAT_24 - -
- 330242..330303 + 62 NuclAT_24 - -
- 330242..330303 + 62 NuclAT_24 - -
- 330242..330303 + 62 NuclAT_24 - -
- 330242..330303 + 62 NuclAT_27 - -
- 330242..330303 + 62 NuclAT_27 - -
- 330242..330303 + 62 NuclAT_27 - -
- 330242..330303 + 62 NuclAT_27 - -
- 330242..330303 + 62 NuclAT_30 - -
- 330242..330303 + 62 NuclAT_30 - -
- 330242..330303 + 62 NuclAT_30 - -
- 330242..330303 + 62 NuclAT_30 - -
- 330242..330304 + 63 NuclAT_50 - -
- 330242..330304 + 63 NuclAT_50 - -
- 330242..330304 + 63 NuclAT_50 - -
- 330242..330304 + 63 NuclAT_50 - -
- 330242..330304 + 63 NuclAT_53 - -
- 330242..330304 + 63 NuclAT_53 - -
- 330242..330304 + 63 NuclAT_53 - -
- 330242..330304 + 63 NuclAT_53 - -
- 330242..330304 + 63 NuclAT_56 - -
- 330242..330304 + 63 NuclAT_56 - -
- 330242..330304 + 63 NuclAT_56 - -
- 330242..330304 + 63 NuclAT_56 - -
- 330242..330305 + 64 NuclAT_33 - -
- 330242..330305 + 64 NuclAT_33 - -
- 330242..330305 + 64 NuclAT_33 - -
- 330242..330305 + 64 NuclAT_33 - -
- 330242..330305 + 64 NuclAT_36 - -
- 330242..330305 + 64 NuclAT_36 - -
- 330242..330305 + 64 NuclAT_36 - -
- 330242..330305 + 64 NuclAT_36 - -
- 330242..330305 + 64 NuclAT_39 - -
- 330242..330305 + 64 NuclAT_39 - -
- 330242..330305 + 64 NuclAT_39 - -
- 330242..330305 + 64 NuclAT_39 - -
- 330242..330305 + 64 NuclAT_42 - -
- 330242..330305 + 64 NuclAT_42 - -
- 330242..330305 + 64 NuclAT_42 - -
- 330242..330305 + 64 NuclAT_42 - -
- 330242..330305 + 64 NuclAT_45 - -
- 330242..330305 + 64 NuclAT_45 - -
- 330242..330305 + 64 NuclAT_45 - -
- 330242..330305 + 64 NuclAT_45 - -
- 330242..330305 + 64 NuclAT_48 - -
- 330242..330305 + 64 NuclAT_48 - -
- 330242..330305 + 64 NuclAT_48 - -
- 330242..330305 + 64 NuclAT_48 - -
J1F34_RS01655 330618..330725 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 330772..330838 + 67 - - Antitoxin
J1F34_RS01660 331130..332230 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
J1F34_RS01665 332500..332730 + 231 WP_001146442.1 putative cation transport regulator ChaB -
J1F34_RS01670 332888..333583 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
J1F34_RS01675 333627..333980 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
J1F34_RS01680 334165..335559 + 1395 WP_000086201.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T196399 WP_000170965.1 NZ_CP071441:c330725-330618 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T196399 NZ_CP095116:2065835-2066023 [Staphylococcus aureus]
ATGTCTTTACATTTTGCAATTCTTTTTTGGCTAGCATTAATTTTCTTAGTTGCCGCTACGTTTATACTCGTATTAATGAA
AAAAACTGGCAAAGAATCTAAAAAAGAGTCCTATTTAAGTTTCACTGTCATTCTCTATATTTTCGGATTCGCTATTTTAA
TATACACATTTATATTTGGTGTACTATAA

Antitoxin


Download         Length: 67 bp

>AT196399 NZ_CP071441:330772-330838 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References