Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4943291..4943512 Replicon chromosome
Accession NZ_CP071439
Organism Escherichia coli strain EcPNK004

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag J1F19_RS23195 Protein ID WP_000170965.1
Coordinates 4943291..4943398 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4943446..4943512 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
J1F19_RS23170 4939136..4940218 + 1083 WP_000804726.1 peptide chain release factor 1 -
J1F19_RS23175 4940218..4941051 + 834 WP_001586940.1 peptide chain release factor N(5)-glutamine methyltransferase -
J1F19_RS23180 4941048..4941440 + 393 WP_000200387.1 invasion regulator SirB2 -
J1F19_RS23185 4941444..4942253 + 810 WP_001257044.1 invasion regulator SirB1 -
J1F19_RS23190 4942289..4943143 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
J1F19_RS23195 4943291..4943398 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4943446..4943512 + 67 NuclAT_16 - Antitoxin
- 4943446..4943512 + 67 NuclAT_16 - Antitoxin
- 4943446..4943512 + 67 NuclAT_16 - Antitoxin
- 4943446..4943512 + 67 NuclAT_16 - Antitoxin
- 4943446..4943512 + 67 NuclAT_18 - Antitoxin
- 4943446..4943512 + 67 NuclAT_18 - Antitoxin
- 4943446..4943512 + 67 NuclAT_18 - Antitoxin
- 4943446..4943512 + 67 NuclAT_18 - Antitoxin
- 4943446..4943512 + 67 NuclAT_20 - Antitoxin
- 4943446..4943512 + 67 NuclAT_20 - Antitoxin
- 4943446..4943512 + 67 NuclAT_20 - Antitoxin
- 4943446..4943512 + 67 NuclAT_20 - Antitoxin
- 4943446..4943512 + 67 NuclAT_22 - Antitoxin
- 4943446..4943512 + 67 NuclAT_22 - Antitoxin
- 4943446..4943512 + 67 NuclAT_22 - Antitoxin
- 4943446..4943512 + 67 NuclAT_22 - Antitoxin
- 4943446..4943512 + 67 NuclAT_24 - Antitoxin
- 4943446..4943512 + 67 NuclAT_24 - Antitoxin
- 4943446..4943512 + 67 NuclAT_24 - Antitoxin
- 4943446..4943512 + 67 NuclAT_24 - Antitoxin
- 4943446..4943512 + 67 NuclAT_26 - Antitoxin
- 4943446..4943512 + 67 NuclAT_26 - Antitoxin
- 4943446..4943512 + 67 NuclAT_26 - Antitoxin
- 4943446..4943512 + 67 NuclAT_26 - Antitoxin
- 4943448..4943511 + 64 NuclAT_29 - -
- 4943448..4943511 + 64 NuclAT_29 - -
- 4943448..4943511 + 64 NuclAT_29 - -
- 4943448..4943511 + 64 NuclAT_29 - -
- 4943448..4943511 + 64 NuclAT_31 - -
- 4943448..4943511 + 64 NuclAT_31 - -
- 4943448..4943511 + 64 NuclAT_31 - -
- 4943448..4943511 + 64 NuclAT_31 - -
- 4943448..4943511 + 64 NuclAT_33 - -
- 4943448..4943511 + 64 NuclAT_33 - -
- 4943448..4943511 + 64 NuclAT_33 - -
- 4943448..4943511 + 64 NuclAT_33 - -
- 4943448..4943511 + 64 NuclAT_35 - -
- 4943448..4943511 + 64 NuclAT_35 - -
- 4943448..4943511 + 64 NuclAT_35 - -
- 4943448..4943511 + 64 NuclAT_35 - -
- 4943448..4943511 + 64 NuclAT_37 - -
- 4943448..4943511 + 64 NuclAT_37 - -
- 4943448..4943511 + 64 NuclAT_37 - -
- 4943448..4943511 + 64 NuclAT_37 - -
- 4943448..4943511 + 64 NuclAT_39 - -
- 4943448..4943511 + 64 NuclAT_39 - -
- 4943448..4943511 + 64 NuclAT_39 - -
- 4943448..4943511 + 64 NuclAT_39 - -
- 4943448..4943513 + 66 NuclAT_41 - -
- 4943448..4943513 + 66 NuclAT_41 - -
- 4943448..4943513 + 66 NuclAT_41 - -
- 4943448..4943513 + 66 NuclAT_41 - -
- 4943448..4943513 + 66 NuclAT_43 - -
- 4943448..4943513 + 66 NuclAT_43 - -
- 4943448..4943513 + 66 NuclAT_43 - -
- 4943448..4943513 + 66 NuclAT_43 - -
J1F19_RS23200 4943826..4943933 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 4943986..4944047 + 62 NuclAT_28 - -
- 4943986..4944047 + 62 NuclAT_28 - -
- 4943986..4944047 + 62 NuclAT_28 - -
- 4943986..4944047 + 62 NuclAT_28 - -
- 4943986..4944047 + 62 NuclAT_30 - -
- 4943986..4944047 + 62 NuclAT_30 - -
- 4943986..4944047 + 62 NuclAT_30 - -
- 4943986..4944047 + 62 NuclAT_30 - -
- 4943986..4944047 + 62 NuclAT_32 - -
- 4943986..4944047 + 62 NuclAT_32 - -
- 4943986..4944047 + 62 NuclAT_32 - -
- 4943986..4944047 + 62 NuclAT_32 - -
- 4943986..4944047 + 62 NuclAT_34 - -
- 4943986..4944047 + 62 NuclAT_34 - -
- 4943986..4944047 + 62 NuclAT_34 - -
- 4943986..4944047 + 62 NuclAT_34 - -
- 4943986..4944047 + 62 NuclAT_36 - -
- 4943986..4944047 + 62 NuclAT_36 - -
- 4943986..4944047 + 62 NuclAT_36 - -
- 4943986..4944047 + 62 NuclAT_36 - -
- 4943986..4944047 + 62 NuclAT_38 - -
- 4943986..4944047 + 62 NuclAT_38 - -
- 4943986..4944047 + 62 NuclAT_38 - -
- 4943986..4944047 + 62 NuclAT_38 - -
- 4943986..4944048 + 63 NuclAT_17 - -
- 4943986..4944048 + 63 NuclAT_17 - -
- 4943986..4944048 + 63 NuclAT_17 - -
- 4943986..4944048 + 63 NuclAT_17 - -
- 4943986..4944048 + 63 NuclAT_19 - -
- 4943986..4944048 + 63 NuclAT_19 - -
- 4943986..4944048 + 63 NuclAT_19 - -
- 4943986..4944048 + 63 NuclAT_19 - -
- 4943986..4944048 + 63 NuclAT_21 - -
- 4943986..4944048 + 63 NuclAT_21 - -
- 4943986..4944048 + 63 NuclAT_21 - -
- 4943986..4944048 + 63 NuclAT_21 - -
- 4943986..4944048 + 63 NuclAT_23 - -
- 4943986..4944048 + 63 NuclAT_23 - -
- 4943986..4944048 + 63 NuclAT_23 - -
- 4943986..4944048 + 63 NuclAT_23 - -
- 4943986..4944048 + 63 NuclAT_25 - -
- 4943986..4944048 + 63 NuclAT_25 - -
- 4943986..4944048 + 63 NuclAT_25 - -
- 4943986..4944048 + 63 NuclAT_25 - -
- 4943986..4944048 + 63 NuclAT_27 - -
- 4943986..4944048 + 63 NuclAT_27 - -
- 4943986..4944048 + 63 NuclAT_27 - -
- 4943986..4944048 + 63 NuclAT_27 - -
- 4943986..4944049 + 64 NuclAT_40 - -
- 4943986..4944049 + 64 NuclAT_40 - -
- 4943986..4944049 + 64 NuclAT_40 - -
- 4943986..4944049 + 64 NuclAT_40 - -
- 4943986..4944049 + 64 NuclAT_42 - -
- 4943986..4944049 + 64 NuclAT_42 - -
- 4943986..4944049 + 64 NuclAT_42 - -
- 4943986..4944049 + 64 NuclAT_42 - -
J1F19_RS23205 4944339..4945439 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
J1F19_RS23210 4945709..4945939 + 231 WP_001146444.1 putative cation transport regulator ChaB -
J1F19_RS23215 4946097..4946792 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
J1F19_RS23220 4946836..4947189 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T196389 WP_000170965.1 NZ_CP071439:c4943398-4943291 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T196389 NZ_CP095112:c2182935-2182726 [Staphylococcus aureus]
ATGATACATCAAAATACGATTTACACAGCGGGAATTGAAACAGAAGAACAAGTAAGTCAATTGACAGAACGCATTTCAAA
TATGATAGGTGTTCATCAAGTGATTATTAATATAATAGACGGTCAGGTAACTGTAGCGTATGAGACACCAGCAAATTTGA
ATAGTATTGAAAAAGAAATCTATGATGAAGGATACAAAATTGTATTTTAG

Antitoxin


Download         Length: 67 bp

>AT196389 NZ_CP071439:4943446-4943512 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References