Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-sokW/Ldr(toxin)
Location 2713188..2713407 Replicon chromosome
Accession NZ_CP071263
Organism Escherichia coli strain MEI003

Toxin (Protein)


Gene name ldrD Uniprot ID A0A0J2BSG9
Locus tag J0G23_RS13335 Protein ID WP_001521561.1
Coordinates 2713188..2713295 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2713344..2713407 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
J0G23_RS13310 (2708723) 2708723..2708911 - 189 WP_001063314.1 cellulose biosynthesis protein BcsR -
J0G23_RS13315 (2709183) 2709183..2710754 + 1572 WP_077781651.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
J0G23_RS13320 (2710751) 2710751..2710942 + 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
J0G23_RS13325 (2710939) 2710939..2712618 + 1680 WP_000191589.1 cellulose biosynthesis protein BcsG -
J0G23_RS13330 (2712705) 2712705..2712812 - 108 WP_001560082.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2712870) 2712870..2712924 + 55 NuclAT_19 - -
- (2712870) 2712870..2712924 + 55 NuclAT_19 - -
- (2712870) 2712870..2712924 + 55 NuclAT_19 - -
- (2712870) 2712870..2712924 + 55 NuclAT_19 - -
- (2712870) 2712870..2712924 + 55 NuclAT_23 - -
- (2712870) 2712870..2712924 + 55 NuclAT_23 - -
- (2712870) 2712870..2712924 + 55 NuclAT_23 - -
- (2712870) 2712870..2712924 + 55 NuclAT_23 - -
- (2712870) 2712870..2712924 + 55 NuclAT_27 - -
- (2712870) 2712870..2712924 + 55 NuclAT_27 - -
- (2712870) 2712870..2712924 + 55 NuclAT_27 - -
- (2712870) 2712870..2712924 + 55 NuclAT_27 - -
- (2712870) 2712870..2712924 + 55 NuclAT_33 - -
- (2712870) 2712870..2712924 + 55 NuclAT_33 - -
- (2712870) 2712870..2712924 + 55 NuclAT_33 - -
- (2712870) 2712870..2712924 + 55 NuclAT_33 - -
- (2712870) 2712870..2712926 + 57 NuclAT_13 - -
- (2712870) 2712870..2712926 + 57 NuclAT_13 - -
- (2712870) 2712870..2712926 + 57 NuclAT_13 - -
- (2712870) 2712870..2712926 + 57 NuclAT_13 - -
- (2712870) 2712870..2712926 + 57 NuclAT_15 - -
- (2712870) 2712870..2712926 + 57 NuclAT_15 - -
- (2712870) 2712870..2712926 + 57 NuclAT_15 - -
- (2712870) 2712870..2712926 + 57 NuclAT_15 - -
J0G23_RS13335 (2713188) 2713188..2713295 - 108 WP_001521561.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2713344) 2713344..2713407 + 64 NuclAT_18 - Antitoxin
- (2713344) 2713344..2713407 + 64 NuclAT_18 - Antitoxin
- (2713344) 2713344..2713407 + 64 NuclAT_18 - Antitoxin
- (2713344) 2713344..2713407 + 64 NuclAT_18 - Antitoxin
- (2713344) 2713344..2713407 + 64 NuclAT_22 - Antitoxin
- (2713344) 2713344..2713407 + 64 NuclAT_22 - Antitoxin
- (2713344) 2713344..2713407 + 64 NuclAT_22 - Antitoxin
- (2713344) 2713344..2713407 + 64 NuclAT_22 - Antitoxin
- (2713344) 2713344..2713407 + 64 NuclAT_26 - Antitoxin
- (2713344) 2713344..2713407 + 64 NuclAT_26 - Antitoxin
- (2713344) 2713344..2713407 + 64 NuclAT_26 - Antitoxin
- (2713344) 2713344..2713407 + 64 NuclAT_26 - Antitoxin
- (2713344) 2713344..2713407 + 64 NuclAT_32 - Antitoxin
- (2713344) 2713344..2713407 + 64 NuclAT_32 - Antitoxin
- (2713344) 2713344..2713407 + 64 NuclAT_32 - Antitoxin
- (2713344) 2713344..2713407 + 64 NuclAT_32 - Antitoxin
- (2713344) 2713344..2713409 + 66 NuclAT_12 - -
- (2713344) 2713344..2713409 + 66 NuclAT_12 - -
- (2713344) 2713344..2713409 + 66 NuclAT_12 - -
- (2713344) 2713344..2713409 + 66 NuclAT_12 - -
- (2713344) 2713344..2713409 + 66 NuclAT_14 - -
- (2713344) 2713344..2713409 + 66 NuclAT_14 - -
- (2713344) 2713344..2713409 + 66 NuclAT_14 - -
- (2713344) 2713344..2713409 + 66 NuclAT_14 - -
J0G23_RS13340 (2713771) 2713771..2715042 + 1272 WP_001560083.1 aromatic amino acid transport family protein -
J0G23_RS13345 (2715072) 2715072..2716076 - 1005 WP_000103580.1 dipeptide ABC transporter ATP-binding subunit DppF -
J0G23_RS13350 (2716073) 2716073..2717056 - 984 WP_001196487.1 dipeptide ABC transporter ATP-binding protein -
J0G23_RS13355 (2717067) 2717067..2717969 - 903 WP_000084677.1 dipeptide ABC transporter permease DppC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3914.76 Da        Isoelectric Point: 9.0157

>T196104 WP_001521561.1 NZ_CP071263:c2713295-2713188 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIMNWLNKRK

Download         Length: 108 bp

>T196104 NZ_CP095021:709386-709787 [Mycobacterium tuberculosis]
GTGACGGTGCTGCTCGACGCCAACGTGCTGATCGCATTGGTGGTCGCCGAGCATGTGCATCATGATGCCGCAGCGGACTG
GCTCATGGCGTCCGACACCGGATTTGCGACCTGCCCGATGACACAAGGAAGCCTGGTTCGATTCCTGGTGCGCTCGGGAC
AGTCCGCGGCGGCGGCTCGGGATGTCGTCAGTGCGGTCCAGTGCACGAGCCGCCACGAATTCTGGCCCGATGCACTCTCT
TTCGCCGGTGTCGAGGTCGCTGGTGTGGTTGGGCACCGGCAGGTGACCGATGCCTACCTTGCCCAGCTCGCGCGAAGCCA
CGACGGGCAGTTGGCGACGCTCGACAGCGGCTTAGCACACCTGCACGGCGACGTCGCGGTACTCATTCCAACGACCACCT
GA

Antitoxin


Download         Length: 64 bp

>AT196104 NZ_CP071263:2713344-2713407 [Escherichia coli]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2BSG9

Antitoxin

Download structure file

References