Detailed information of TA system TA196100

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-sokW/Ldr(toxin)
• Location: 2712705..2712924
• Replicon: chromosome
• Accession: NZ_CP071263
• Organism: Escherichia coli strain MEI003

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: -
• Locus tag: J0G23_RS13330
• Protein ID: WP_001560082.1
• Coordinates: 2712705..2712812 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	sokW
Locus tag	-
Coordinates	2712870..2712924 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
J0G23_RS13305 (2707959)	2707959..2708711	-	753	WP_000279518.1	cellulose biosynthesis protein BcsQ	-
J0G23_RS13310 (2708723)	2708723..2708911	-	189	WP_001063314.1	cellulose biosynthesis protein BcsR	-
J0G23_RS13315 (2709183)	2709183..2710754	+	1572	WP_077781651.1	cellulose biosynthesis c-di-GMP-binding protein BcsE	-
J0G23_RS13320 (2710751)	2710751..2710942	+	192	WP_000988308.1	cellulose biosynthesis protein BcsF	-
J0G23_RS13325 (2710939)	2710939..2712618	+	1680	WP_000191589.1	cellulose biosynthesis protein BcsG	-
J0G23_RS13330 (2712705)	2712705..2712812	-	108	WP_001560082.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
- (2712870)	2712870..2712924	+	55	NuclAT_19	-	Antitoxin
- (2712870)	2712870..2712924	+	55	NuclAT_19	-	Antitoxin
- (2712870)	2712870..2712924	+	55	NuclAT_19	-	Antitoxin
- (2712870)	2712870..2712924	+	55	NuclAT_19	-	Antitoxin
- (2712870)	2712870..2712924	+	55	NuclAT_23	-	Antitoxin
- (2712870)	2712870..2712924	+	55	NuclAT_23	-	Antitoxin
- (2712870)	2712870..2712924	+	55	NuclAT_23	-	Antitoxin
- (2712870)	2712870..2712924	+	55	NuclAT_23	-	Antitoxin
- (2712870)	2712870..2712924	+	55	NuclAT_27	-	Antitoxin
- (2712870)	2712870..2712924	+	55	NuclAT_27	-	Antitoxin
- (2712870)	2712870..2712924	+	55	NuclAT_27	-	Antitoxin
- (2712870)	2712870..2712924	+	55	NuclAT_27	-	Antitoxin
- (2712870)	2712870..2712924	+	55	NuclAT_33	-	Antitoxin
- (2712870)	2712870..2712924	+	55	NuclAT_33	-	Antitoxin
- (2712870)	2712870..2712924	+	55	NuclAT_33	-	Antitoxin
- (2712870)	2712870..2712924	+	55	NuclAT_33	-	Antitoxin
- (2712870)	2712870..2712926	+	57	NuclAT_13	-	-
- (2712870)	2712870..2712926	+	57	NuclAT_13	-	-
- (2712870)	2712870..2712926	+	57	NuclAT_13	-	-
- (2712870)	2712870..2712926	+	57	NuclAT_13	-	-
- (2712870)	2712870..2712926	+	57	NuclAT_15	-	-
- (2712870)	2712870..2712926	+	57	NuclAT_15	-	-
- (2712870)	2712870..2712926	+	57	NuclAT_15	-	-
- (2712870)	2712870..2712926	+	57	NuclAT_15	-	-
J0G23_RS13335 (2713188)	2713188..2713295	-	108	WP_001521561.1	type I toxin-antitoxin system toxin Ldr family protein	-
- (2713344)	2713344..2713407	+	64	NuclAT_18	-	-
- (2713344)	2713344..2713407	+	64	NuclAT_18	-	-
- (2713344)	2713344..2713407	+	64	NuclAT_18	-	-
- (2713344)	2713344..2713407	+	64	NuclAT_18	-	-
- (2713344)	2713344..2713407	+	64	NuclAT_22	-	-
- (2713344)	2713344..2713407	+	64	NuclAT_22	-	-
- (2713344)	2713344..2713407	+	64	NuclAT_22	-	-
- (2713344)	2713344..2713407	+	64	NuclAT_22	-	-
- (2713344)	2713344..2713407	+	64	NuclAT_26	-	-
- (2713344)	2713344..2713407	+	64	NuclAT_26	-	-
- (2713344)	2713344..2713407	+	64	NuclAT_26	-	-
- (2713344)	2713344..2713407	+	64	NuclAT_26	-	-
- (2713344)	2713344..2713407	+	64	NuclAT_32	-	-
- (2713344)	2713344..2713407	+	64	NuclAT_32	-	-
- (2713344)	2713344..2713407	+	64	NuclAT_32	-	-
- (2713344)	2713344..2713407	+	64	NuclAT_32	-	-
- (2713344)	2713344..2713409	+	66	NuclAT_12	-	-
- (2713344)	2713344..2713409	+	66	NuclAT_12	-	-
- (2713344)	2713344..2713409	+	66	NuclAT_12	-	-
- (2713344)	2713344..2713409	+	66	NuclAT_12	-	-
- (2713344)	2713344..2713409	+	66	NuclAT_14	-	-
- (2713344)	2713344..2713409	+	66	NuclAT_14	-	-
- (2713344)	2713344..2713409	+	66	NuclAT_14	-	-
- (2713344)	2713344..2713409	+	66	NuclAT_14	-	-
J0G23_RS13340 (2713771)	2713771..2715042	+	1272	WP_001560083.1	aromatic amino acid transport family protein	-
J0G23_RS13345 (2715072)	2715072..2716076	-	1005	WP_000103580.1	dipeptide ABC transporter ATP-binding subunit DppF	-
J0G23_RS13350 (2716073)	2716073..2717056	-	984	WP_001196487.1	dipeptide ABC transporter ATP-binding protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3779.56 Da
• Isoelectric Point: 9.0157

>T196100 WP_001560082.1 NZ_CP071263:c2712812-2712705 [Escherichia coli]
MTLAELGMAFWHDLAAPIIAGILASLIVNSLNKRK

Nucleotide

• Length: 108 bp

>T196100 NZ_CP095021:676301-676708 [Mycobacterium tuberculosis]
GTGATCATCGACACGAGTGCGCTGCTTGCCTATTTCGACGCCGCCGAGCCAGACCACGCCGCAGTGTCTGAGTGCATCGA
TAGCTCCGCAGACGCGCTCGTCGTATCCCCTTATGTGGTAGCGGAACTCGACTATCTCGTCGCCACCCGGGTAGGTGTCG
ATGCCGAGCTCGCCGTCCTGCGTGAACTCGCCGGCGGGGCCTGGGAGCTCGCCAACTGCGGTGCCGCCGAAATCGAGCAG
GCCGCCCGCATCGTCACGAAATACCAGGATCAGCGGATCGGGATCGCGGATGCGGCCAACGTCGTGCTGGCCGACCGATA
CCGCACGCGCACGATCCTCACCCTGGACCGTCGGCACTTCTCGGCGCTGCGGCCGATCGGCGGTGGGCGCTTCACCGTCA
TTCCGTAA

Antitoxin

Nucleotide

• Length: 55 bp

>AT196100 NZ_CP071263:2712870-2712924 [Escherichia coli]
CAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Structures

Antitoxin