Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 274611..274806 | Replicon | chromosome |
Accession | NZ_CP071176 | ||
Organism | Enterococcus faecalis strain L18 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | JZP79_RS01460 | Protein ID | WP_015543884.1 |
Coordinates | 274711..274806 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 274611..274676 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JZP79_RS01445 | 270242..271984 | + | 1743 | WP_002401739.1 | PTS transporter subunit EIIC | - |
JZP79_RS01450 | 271975..274008 | + | 2034 | WP_002355275.1 | transcription antiterminator | - |
JZP79_RS01455 | 274019..274453 | + | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
- | 274611..274676 | + | 66 | - | - | Antitoxin |
JZP79_RS01460 | 274711..274806 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
JZP79_RS01465 | 275052..276824 | + | 1773 | WP_002391520.1 | PTS mannitol transporter subunit IICBA | - |
JZP79_RS01470 | 276839..277276 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
JZP79_RS01475 | 277291..278445 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
JZP79_RS01480 | 278514..279629 | - | 1116 | WP_002377910.1 | FAD-binding oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T195504 WP_015543884.1 NZ_CP071176:c274806-274711 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T195504 NZ_CP094747:c2012039-2011887 [Staphylococcus aureus]
ATGTCTAAAGACAAAGATCCAAAATTAAATTATCATGAAGAAGAAAACAGTATGGTAACTGATTTTGAAGATTTAAAAGA
ATTAGGTAAAGAAATGGAACAAATTTCTGATCAAAATGATCAAGAAAAGAATTCTGAAGAAGACAGTCAGTAA
ATGTCTAAAGACAAAGATCCAAAATTAAATTATCATGAAGAAGAAAACAGTATGGTAACTGATTTTGAAGATTTAAAAGA
ATTAGGTAAAGAAATGGAACAAATTTCTGATCAAAATGATCAAGAAAAGAATTCTGAAGAAGACAGTCAGTAA
Antitoxin
Download Length: 66 bp
>AT195504 NZ_CP071176:274611-274676 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|