Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 47547..47811 | Replicon | plasmid p3347558_3 |
| Accession | NZ_CP071076 | ||
| Organism | Escherichia coli strain 3347558 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | JY392_RS26975 | Protein ID | WP_001331364.1 |
| Coordinates | 47659..47811 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 47547..47609 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JY392_RS26960 (43650) | 43650..44720 | - | 1071 | WP_031942445.1 | IncI1-type conjugal transfer protein TrbB | - |
| JY392_RS26965 (44739) | 44739..45947 | - | 1209 | WP_001703845.1 | IncI1-type conjugal transfer protein TrbA | - |
| JY392_RS26970 (46253) | 46253..47032 | - | 780 | WP_275542888.1 | protein FinQ | - |
| - (47547) | 47547..47609 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (47547) | 47547..47609 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (47547) | 47547..47609 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (47547) | 47547..47609 | - | 63 | NuclAT_0 | - | Antitoxin |
| JY392_RS26975 (47659) | 47659..47811 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| JY392_RS26980 (47883) | 47883..48134 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| JY392_RS28165 (48635) | 48635..48730 | + | 96 | WP_000609148.1 | DinQ-like type I toxin DqlB | - |
| JY392_RS26990 (48795) | 48795..48971 | - | 177 | WP_001054898.1 | hypothetical protein | - |
| JY392_RS26995 (49154) | 49154..49363 | - | 210 | WP_001140543.1 | hemolysin expression modulator Hha | - |
| JY392_RS27000 (49461) | 49461..50075 | - | 615 | WP_000578648.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| JY392_RS27005 (50151) | 50151..52319 | - | 2169 | WP_031942447.1 | IncI1-type conjugal transfer membrane protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-15 / aac(3)-IId / blaTEM-1B | - | 1..93750 | 93750 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T195232 WP_001331364.1 NZ_CP071076:47659-47811 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T195232 NZ_CP094443:2740438-2740542 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 63 bp
>AT195232 NZ_CP071076:c47609-47547 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|