Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 13599..14256 | Replicon | plasmid p3347558_1 |
Accession | NZ_CP071074 | ||
Organism | Escherichia coli strain 3347558 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U3PDC3 |
Locus tag | JY392_RS25105 | Protein ID | WP_000270043.1 |
Coordinates | 13906..14256 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | JY392_RS25100 | Protein ID | WP_000124640.1 |
Coordinates | 13599..13901 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JY392_RS25050 (JY392_25045) | 9233..9661 | + | 429 | WP_000591076.1 | hypothetical protein | - |
JY392_RS25055 (JY392_25050) | 9719..10078 | + | 360 | WP_000422769.1 | hypothetical protein | - |
JY392_RS25060 (JY392_25055) | 10078..10524 | + | 447 | WP_000919343.1 | hypothetical protein | - |
JY392_RS25065 (JY392_25060) | 10521..11039 | + | 519 | WP_000210757.1 | nitrite reductase | - |
JY392_RS25070 (JY392_25065) | 11039..11269 | + | 231 | WP_000972665.1 | hypothetical protein | - |
JY392_RS25075 (JY392_25070) | 11256..12113 | + | 858 | WP_001167036.1 | hypothetical protein | - |
JY392_RS27990 | 12139..12330 | + | 192 | WP_001270409.1 | hypothetical protein | - |
JY392_RS25085 (JY392_25080) | 12333..12860 | + | 528 | WP_004201083.1 | thermonuclease family protein | - |
JY392_RS25090 (JY392_25085) | 12918..13190 | + | 273 | WP_001043046.1 | HU family DNA-binding protein | - |
JY392_RS25095 (JY392_25090) | 13279..13572 | + | 294 | WP_001239998.1 | hypothetical protein | - |
JY392_RS25100 (JY392_25095) | 13599..13901 | - | 303 | WP_000124640.1 | XRE family transcriptional regulator | Antitoxin |
JY392_RS25105 (JY392_25100) | 13906..14256 | - | 351 | WP_000270043.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JY392_RS25110 (JY392_25105) | 14419..14967 | + | 549 | WP_001061573.1 | hypothetical protein | - |
JY392_RS25115 (JY392_25110) | 15308..15502 | + | 195 | WP_000343597.1 | hypothetical protein | - |
JY392_RS25120 (JY392_25115) | 15513..15884 | + | 372 | WP_000516918.1 | hypothetical protein | - |
JY392_RS25125 (JY392_25120) | 15877..16347 | + | 471 | WP_001281821.1 | hypothetical protein | - |
JY392_RS25130 (JY392_25125) | 16362..16697 | - | 336 | WP_000683477.1 | hypothetical protein | - |
JY392_RS25135 (JY392_25130) | 16794..17282 | + | 489 | WP_001273096.1 | DUF1643 domain-containing protein | - |
JY392_RS25140 (JY392_25135) | 17285..17782 | + | 498 | WP_000062185.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCMY-4 / dfrA14 / ARR-3 / cmlA1 / blaOXA-10 / ant(3'')-Ia / qacE / sul1 / aph(3')-VI / blaNDM-1 / armA / msr(E) / mph(E) | - | 1..169082 | 169082 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13328.21 Da Isoelectric Point: 5.2421
>T195230 WP_000270043.1 NZ_CP071074:c14256-13906 [Escherichia coli]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
Download Length: 351 bp
>T195230 NZ_CP094443:2455467-2455574 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 101 a.a. Molecular weight: 11006.73 Da Isoelectric Point: 7.2036
>AT195230 WP_000124640.1 NZ_CP071074:c13901-13599 [Escherichia coli]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV
Download Length: 303 bp
>AT195230 NZ_CP094443:c2455651-2455591 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|