Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF1/- |
Location | 1995675..1995982 | Replicon | chromosome |
Accession | NZ_CP070983 | ||
Organism | Staphylococcus aureus strain WBG8366 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | JX573_RS09795 | Protein ID | WP_072353918.1 |
Coordinates | 1995806..1995982 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 1995675..1995814 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JX573_RS09755 | 1991241..1991420 | + | 180 | WP_000669791.1 | hypothetical protein | - |
JX573_RS09760 | 1991731..1991991 | + | 261 | WP_001791826.1 | hypothetical protein | - |
JX573_RS09765 | 1992044..1992394 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
JX573_RS09770 | 1992905..1993240 | - | 336 | Protein_1885 | SH3 domain-containing protein | - |
JX573_RS09775 | 1993891..1994382 | - | 492 | WP_000920038.1 | staphylokinase | - |
JX573_RS09780 | 1994573..1995328 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
JX573_RS09785 | 1995340..1995594 | - | 255 | WP_000611512.1 | phage holin | - |
JX573_RS09790 | 1995646..1995753 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 1995675..1995814 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 1995675..1995814 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 1995675..1995814 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 1995675..1995814 | + | 140 | NuclAT_0 | - | Antitoxin |
JX573_RS09795 | 1995806..1995982 | - | 177 | WP_072353918.1 | putative holin-like toxin | Toxin |
JX573_RS09800 | 1996125..1996499 | - | 375 | WP_000340977.1 | hypothetical protein | - |
JX573_RS09805 | 1996555..1996842 | - | 288 | WP_001262620.1 | hypothetical protein | - |
JX573_RS09810 | 1996888..1997040 | - | 153 | WP_001000058.1 | hypothetical protein | - |
JX573_RS09815 | 1997033..2000815 | - | 3783 | WP_000582132.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / hlb / groEL | 1992044..2045722 | 53678 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6810.43 Da Isoelectric Point: 9.9479
>T194915 WP_072353918.1 NZ_CP070983:c1995982-1995806 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T194915 NZ_CP094227:c4138005-4137903 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 140 bp
>AT194915 NZ_CP070983:1995675-1995814 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|