Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-sokA/Ldr(toxin)
Location 4206167..4206386 Replicon chromosome
Accession NZ_CP070951
Organism Escherichia fergusonii strain EF31

Toxin (Protein)


Gene name ldrD Uniprot ID A0A829L523
Locus tag JW961_RS20200 Protein ID WP_000170738.1
Coordinates 4206167..4206274 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name sokA
Locus tag -
Coordinates 4206323..4206386 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JW961_RS20175 (4201698) 4201698..4201886 - 189 WP_001063310.1 cellulose biosynthesis protein BcsR -
JW961_RS20180 (4202173) 4202173..4203732 + 1560 WP_001070267.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
JW961_RS20185 (4203729) 4203729..4203920 + 192 WP_000981122.1 cellulose biosynthesis protein BcsF -
JW961_RS20190 (4203917) 4203917..4205596 + 1680 WP_000192007.1 cellulose biosynthesis protein BcsG -
JW961_RS20195 (4205683) 4205683..4205790 - 108 WP_002431793.1 type I toxin-antitoxin system toxin Ldr family protein -
JW961_RS20200 (4206167) 4206167..4206274 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4206323) 4206323..4206386 + 64 NuclAT_16 - Antitoxin
- (4206323) 4206323..4206386 + 64 NuclAT_16 - Antitoxin
- (4206323) 4206323..4206386 + 64 NuclAT_16 - Antitoxin
- (4206323) 4206323..4206386 + 64 NuclAT_16 - Antitoxin
- (4206323) 4206323..4206386 + 64 NuclAT_18 - Antitoxin
- (4206323) 4206323..4206386 + 64 NuclAT_18 - Antitoxin
- (4206323) 4206323..4206386 + 64 NuclAT_18 - Antitoxin
- (4206323) 4206323..4206386 + 64 NuclAT_18 - Antitoxin
- (4206323) 4206323..4206386 + 64 NuclAT_20 - Antitoxin
- (4206323) 4206323..4206386 + 64 NuclAT_20 - Antitoxin
- (4206323) 4206323..4206386 + 64 NuclAT_20 - Antitoxin
- (4206323) 4206323..4206386 + 64 NuclAT_20 - Antitoxin
- (4206323) 4206323..4206386 + 64 NuclAT_22 - Antitoxin
- (4206323) 4206323..4206386 + 64 NuclAT_22 - Antitoxin
- (4206323) 4206323..4206386 + 64 NuclAT_22 - Antitoxin
- (4206323) 4206323..4206386 + 64 NuclAT_22 - Antitoxin
- (4206323) 4206323..4206388 + 66 NuclAT_11 - -
- (4206323) 4206323..4206388 + 66 NuclAT_11 - -
- (4206323) 4206323..4206388 + 66 NuclAT_11 - -
- (4206323) 4206323..4206388 + 66 NuclAT_11 - -
- (4206323) 4206323..4206388 + 66 NuclAT_13 - -
- (4206323) 4206323..4206388 + 66 NuclAT_13 - -
- (4206323) 4206323..4206388 + 66 NuclAT_13 - -
- (4206323) 4206323..4206388 + 66 NuclAT_13 - -
JW961_RS20205 (4206649) 4206649..4206756 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
- (4206805) 4206805..4206868 + 64 NuclAT_15 - -
- (4206805) 4206805..4206868 + 64 NuclAT_15 - -
- (4206805) 4206805..4206868 + 64 NuclAT_15 - -
- (4206805) 4206805..4206868 + 64 NuclAT_15 - -
- (4206805) 4206805..4206868 + 64 NuclAT_17 - -
- (4206805) 4206805..4206868 + 64 NuclAT_17 - -
- (4206805) 4206805..4206868 + 64 NuclAT_17 - -
- (4206805) 4206805..4206868 + 64 NuclAT_17 - -
- (4206805) 4206805..4206868 + 64 NuclAT_19 - -
- (4206805) 4206805..4206868 + 64 NuclAT_19 - -
- (4206805) 4206805..4206868 + 64 NuclAT_19 - -
- (4206805) 4206805..4206868 + 64 NuclAT_19 - -
- (4206805) 4206805..4206868 + 64 NuclAT_21 - -
- (4206805) 4206805..4206868 + 64 NuclAT_21 - -
- (4206805) 4206805..4206868 + 64 NuclAT_21 - -
- (4206805) 4206805..4206868 + 64 NuclAT_21 - -
- (4206805) 4206805..4206870 + 66 NuclAT_10 - -
- (4206805) 4206805..4206870 + 66 NuclAT_10 - -
- (4206805) 4206805..4206870 + 66 NuclAT_10 - -
- (4206805) 4206805..4206870 + 66 NuclAT_10 - -
- (4206805) 4206805..4206870 + 66 NuclAT_12 - -
- (4206805) 4206805..4206870 + 66 NuclAT_12 - -
- (4206805) 4206805..4206870 + 66 NuclAT_12 - -
- (4206805) 4206805..4206870 + 66 NuclAT_12 - -
JW961_RS20210 (4207193) 4207193..4208389 + 1197 WP_223662704.1 methionine gamma-lyase -
JW961_RS20215 (4208639) 4208639..4209937 + 1299 WP_223662706.1 amino acid permease -
JW961_RS20220 (4209953) 4209953..4211164 - 1212 WP_223662708.1 sigma 54-interacting transcriptional regulator -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3864.67 Da        Isoelectric Point: 9.0157

>T194743 WP_000170738.1 NZ_CP070951:c4206274-4206167 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK

Download         Length: 108 bp

>T194743 NZ_CP093957:c175504-175388 [Enterococcus faecalis]
ATGTTTTTGTCCGTTGAAGCAGCGCTAGGACTGATGATTGGTTTTGCAACACTTGTTGTGACCATTATCTTCGGTATCTT
AGCGCTTGTCTTAGACAACAAAAATAACCGTTCATAA

Antitoxin


Download         Length: 64 bp

>AT194743 NZ_CP070951:4206323-4206386 [Escherichia fergusonii]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A829L523


Antitoxin

Download structure file

References