Detailed information of TA system TA194525

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-OrzO/Ldr(toxin)
• Location: 1005048..1005267
• Replicon: chromosome
• Accession: NZ_CP070873
• Organism: Escherichia fergusonii strain EF91

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: A0A829L523
• Locus tag: JW972_RS04825
• Protein ID: WP_000170738.1
• Coordinates: 1005048..1005155 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	OrzO
Locus tag	-
Coordinates	1005212..1005267 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
JW972_RS04800 (1000582)	1000582..1000770	-	189	WP_001063310.1	cellulose biosynthesis protein BcsR	-
JW972_RS04805 (1001057)	1001057..1002616	+	1560	WP_223666506.1	cellulose biosynthesis c-di-GMP-binding protein BcsE	-
JW972_RS04810 (1002613)	1002613..1002804	+	192	WP_000981122.1	cellulose biosynthesis protein BcsF	-
JW972_RS04815 (1002801)	1002801..1004480	+	1680	WP_000192007.1	cellulose biosynthesis protein BcsG	-
JW972_RS04820 (1004567)	1004567..1004674	-	108	WP_114091462.1	type I toxin-antitoxin system toxin Ldr family protein	-
JW972_RS04825 (1005048)	1005048..1005155	-	108	WP_000170738.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
- (1005212)	1005212..1005267	+	56	NuclAT_13	-	Antitoxin
- (1005212)	1005212..1005267	+	56	NuclAT_13	-	Antitoxin
- (1005212)	1005212..1005267	+	56	NuclAT_13	-	Antitoxin
- (1005212)	1005212..1005267	+	56	NuclAT_13	-	Antitoxin
- (1005212)	1005212..1005267	+	56	NuclAT_14	-	Antitoxin
- (1005212)	1005212..1005267	+	56	NuclAT_14	-	Antitoxin
- (1005212)	1005212..1005267	+	56	NuclAT_14	-	Antitoxin
- (1005212)	1005212..1005267	+	56	NuclAT_14	-	Antitoxin
- (1005212)	1005212..1005267	+	56	NuclAT_15	-	Antitoxin
- (1005212)	1005212..1005267	+	56	NuclAT_15	-	Antitoxin
- (1005212)	1005212..1005267	+	56	NuclAT_15	-	Antitoxin
- (1005212)	1005212..1005267	+	56	NuclAT_15	-	Antitoxin
- (1005212)	1005212..1005267	+	56	NuclAT_16	-	Antitoxin
- (1005212)	1005212..1005267	+	56	NuclAT_16	-	Antitoxin
- (1005212)	1005212..1005267	+	56	NuclAT_16	-	Antitoxin
- (1005212)	1005212..1005267	+	56	NuclAT_16	-	Antitoxin
- (1005212)	1005212..1005269	+	58	NuclAT_11	-	-
- (1005212)	1005212..1005269	+	58	NuclAT_11	-	-
- (1005212)	1005212..1005269	+	58	NuclAT_11	-	-
- (1005212)	1005212..1005269	+	58	NuclAT_11	-	-
- (1005212)	1005212..1005269	+	58	NuclAT_12	-	-
- (1005212)	1005212..1005269	+	58	NuclAT_12	-	-
- (1005212)	1005212..1005269	+	58	NuclAT_12	-	-
- (1005212)	1005212..1005269	+	58	NuclAT_12	-	-
JW972_RS04830 (1005530)	1005530..1005637	-	108	WP_223678338.1	type I toxin-antitoxin system toxin Ldr family protein	-
JW972_RS04835 (1006073)	1006073..1007269	+	1197	WP_001016304.1	methionine gamma-lyase	-
JW972_RS04840 (1007518)	1007518..1008816	+	1299	WP_001152711.1	amino acid permease	-
JW972_RS04845 (1008832)	1008832..1010043	-	1212	WP_000256500.1	sigma 54-interacting transcriptional regulator	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3864.67 Da
• Isoelectric Point: 9.0157

>T194525 WP_000170738.1 NZ_CP070873:c1005155-1005048 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK

Nucleotide

• Length: 108 bp

>T194525 NZ_CP093548:c1122756-1122653 [Escherichia coli]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT

Antitoxin

Nucleotide

• Length: 56 bp

>AT194525 NZ_CP070873:1005212-1005267 [Escherichia fergusonii]
TCAAGAATGGCCCCCGTCATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Structures

Toxin

• AlphaFold DB: A0A829L523

Antitoxin