Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-OrzO/Ldr(toxin) |
| Location | 1005048..1005267 | Replicon | chromosome |
| Accession | NZ_CP070873 | ||
| Organism | Escherichia fergusonii strain EF91 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A829L523 |
| Locus tag | JW972_RS04825 | Protein ID | WP_000170738.1 |
| Coordinates | 1005048..1005155 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | OrzO | ||
| Locus tag | - | ||
| Coordinates | 1005212..1005267 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JW972_RS04800 (1000582) | 1000582..1000770 | - | 189 | WP_001063310.1 | cellulose biosynthesis protein BcsR | - |
| JW972_RS04805 (1001057) | 1001057..1002616 | + | 1560 | WP_223666506.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| JW972_RS04810 (1002613) | 1002613..1002804 | + | 192 | WP_000981122.1 | cellulose biosynthesis protein BcsF | - |
| JW972_RS04815 (1002801) | 1002801..1004480 | + | 1680 | WP_000192007.1 | cellulose biosynthesis protein BcsG | - |
| JW972_RS04820 (1004567) | 1004567..1004674 | - | 108 | WP_114091462.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| JW972_RS04825 (1005048) | 1005048..1005155 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (1005212) | 1005212..1005267 | + | 56 | NuclAT_13 | - | Antitoxin |
| - (1005212) | 1005212..1005267 | + | 56 | NuclAT_13 | - | Antitoxin |
| - (1005212) | 1005212..1005267 | + | 56 | NuclAT_13 | - | Antitoxin |
| - (1005212) | 1005212..1005267 | + | 56 | NuclAT_13 | - | Antitoxin |
| - (1005212) | 1005212..1005267 | + | 56 | NuclAT_14 | - | Antitoxin |
| - (1005212) | 1005212..1005267 | + | 56 | NuclAT_14 | - | Antitoxin |
| - (1005212) | 1005212..1005267 | + | 56 | NuclAT_14 | - | Antitoxin |
| - (1005212) | 1005212..1005267 | + | 56 | NuclAT_14 | - | Antitoxin |
| - (1005212) | 1005212..1005267 | + | 56 | NuclAT_15 | - | Antitoxin |
| - (1005212) | 1005212..1005267 | + | 56 | NuclAT_15 | - | Antitoxin |
| - (1005212) | 1005212..1005267 | + | 56 | NuclAT_15 | - | Antitoxin |
| - (1005212) | 1005212..1005267 | + | 56 | NuclAT_15 | - | Antitoxin |
| - (1005212) | 1005212..1005267 | + | 56 | NuclAT_16 | - | Antitoxin |
| - (1005212) | 1005212..1005267 | + | 56 | NuclAT_16 | - | Antitoxin |
| - (1005212) | 1005212..1005267 | + | 56 | NuclAT_16 | - | Antitoxin |
| - (1005212) | 1005212..1005267 | + | 56 | NuclAT_16 | - | Antitoxin |
| - (1005212) | 1005212..1005269 | + | 58 | NuclAT_11 | - | - |
| - (1005212) | 1005212..1005269 | + | 58 | NuclAT_11 | - | - |
| - (1005212) | 1005212..1005269 | + | 58 | NuclAT_11 | - | - |
| - (1005212) | 1005212..1005269 | + | 58 | NuclAT_11 | - | - |
| - (1005212) | 1005212..1005269 | + | 58 | NuclAT_12 | - | - |
| - (1005212) | 1005212..1005269 | + | 58 | NuclAT_12 | - | - |
| - (1005212) | 1005212..1005269 | + | 58 | NuclAT_12 | - | - |
| - (1005212) | 1005212..1005269 | + | 58 | NuclAT_12 | - | - |
| JW972_RS04830 (1005530) | 1005530..1005637 | - | 108 | WP_223678338.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| JW972_RS04835 (1006073) | 1006073..1007269 | + | 1197 | WP_001016304.1 | methionine gamma-lyase | - |
| JW972_RS04840 (1007518) | 1007518..1008816 | + | 1299 | WP_001152711.1 | amino acid permease | - |
| JW972_RS04845 (1008832) | 1008832..1010043 | - | 1212 | WP_000256500.1 | sigma 54-interacting transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3864.67 Da Isoelectric Point: 9.0157
>T194525 WP_000170738.1 NZ_CP070873:c1005155-1005048 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
Download Length: 108 bp
>T194525 NZ_CP093548:c1122756-1122653 [Escherichia coli]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 56 bp
>AT194525 NZ_CP070873:1005212-1005267 [Escherichia fergusonii]
TCAAGAATGGCCCCCGTCATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
TCAAGAATGGCCCCCGTCATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|