Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2783411..2783710 | Replicon | chromosome |
Accession | NZ_CP070306 | ||
Organism | Staphylococcus sp. SM9054 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | JQN77_RS13745 | Protein ID | WP_072353918.1 |
Coordinates | 2783534..2783710 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2783411..2783466 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JQN77_RS13705 | 2778969..2779148 | + | 180 | WP_000669789.1 | hypothetical protein | - |
JQN77_RS13710 | 2779459..2779719 | + | 261 | WP_001791826.1 | hypothetical protein | - |
JQN77_RS13715 | 2779772..2780122 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
JQN77_RS13720 | 2780632..2780967 | - | 336 | Protein_2664 | SH3 domain-containing protein | - |
JQN77_RS13725 | 2781619..2782110 | - | 492 | WP_000920041.1 | staphylokinase | - |
JQN77_RS13730 | 2782301..2783056 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
JQN77_RS13735 | 2783068..2783322 | - | 255 | WP_000611512.1 | phage holin | - |
JQN77_RS13740 | 2783374..2783481 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2783403..2783542 | + | 140 | NuclAT_0 | - | - |
- | 2783403..2783542 | + | 140 | NuclAT_0 | - | - |
- | 2783403..2783542 | + | 140 | NuclAT_0 | - | - |
- | 2783403..2783542 | + | 140 | NuclAT_0 | - | - |
- | 2783411..2783466 | + | 56 | - | - | Antitoxin |
JQN77_RS13745 | 2783534..2783710 | - | 177 | WP_072353918.1 | putative holin-like toxin | Toxin |
JQN77_RS13750 | 2783853..2784227 | - | 375 | WP_000340977.1 | hypothetical protein | - |
JQN77_RS13755 | 2784283..2784570 | - | 288 | WP_001262620.1 | hypothetical protein | - |
JQN77_RS13760 | 2784616..2784768 | - | 153 | WP_001000058.1 | hypothetical protein | - |
JQN77_RS13765 | 2784761..2788543 | - | 3783 | WP_001836550.1 | phage protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6810.43 Da Isoelectric Point: 9.9479
>T193827 WP_072353918.1 NZ_CP070306:c2783710-2783534 [Staphylococcus sp. SM9054]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T193827 NZ_CP093226:c4274894-4274721 [Escherichia coli]
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTCCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTCCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
Antitoxin
Download Length: 56 bp
>AT193827 NZ_CP070306:2783411-2783466 [Staphylococcus sp. SM9054]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|