Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 26059..26312 | Replicon | plasmid pESA136_4 |
Accession | NZ_CP070300 | ||
Organism | Escherichia albertii strain Sample 165 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | JRC44_RS25850 | Protein ID | WP_001312851.1 |
Coordinates | 26059..26208 (-) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 26253..26312 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JRC44_RS25815 (21418) | 21418..21833 | - | 416 | Protein_26 | IS1-like element IS1B family transposase | - |
JRC44_RS25820 (22082) | 22082..22483 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
JRC44_RS25825 (22416) | 22416..22673 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
JRC44_RS25830 (22766) | 22766..23419 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
JRC44_RS25835 (24358) | 24358..25215 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
JRC44_RS26895 (25208) | 25208..25282 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
JRC44_RS25845 (25527) | 25527..25775 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
JRC44_RS25850 (26059) | 26059..26208 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
- (26253) | 26253..26312 | + | 60 | NuclAT_0 | - | Antitoxin |
- (26253) | 26253..26312 | + | 60 | NuclAT_0 | - | Antitoxin |
- (26253) | 26253..26312 | + | 60 | NuclAT_0 | - | Antitoxin |
- (26253) | 26253..26312 | + | 60 | NuclAT_0 | - | Antitoxin |
JRC44_RS25855 (26513) | 26513..26845 | - | 333 | WP_152916585.1 | hypothetical protein | - |
JRC44_RS25860 (26907) | 26907..27506 | - | 600 | WP_105906770.1 | PIN domain-containing protein | - |
JRC44_RS25865 (27892) | 27892..28092 | - | 201 | WP_015059022.1 | hypothetical protein | - |
JRC44_RS25870 (28224) | 28224..28784 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
JRC44_RS25875 (28839) | 28839..29585 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-55 / blaTEM-1B / fosA3 | - | 1..97847 | 97847 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T193800 WP_001312851.1 NZ_CP070300:c26208-26059 [Escherichia albertii]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T193800 NZ_CP093221:3734633-3734740 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT193800 NZ_CP070300:26253-26312 [Escherichia albertii]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|