Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 26059..26312 Replicon plasmid pESA136_4
Accession NZ_CP070300
Organism Escherichia albertii strain Sample 165

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag JRC44_RS25850 Protein ID WP_001312851.1
Coordinates 26059..26208 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 26253..26312 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JRC44_RS25815 (21418) 21418..21833 - 416 Protein_26 IS1-like element IS1B family transposase -
JRC44_RS25820 (22082) 22082..22483 - 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -
JRC44_RS25825 (22416) 22416..22673 - 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
JRC44_RS25830 (22766) 22766..23419 - 654 WP_000616807.1 CPBP family intramembrane metalloprotease -
JRC44_RS25835 (24358) 24358..25215 - 858 WP_032495102.1 incFII family plasmid replication initiator RepA -
JRC44_RS26895 (25208) 25208..25282 - 75 WP_001375168.1 RepA leader peptide Tap -
JRC44_RS25845 (25527) 25527..25775 - 249 WP_000083837.1 replication regulatory protein RepA -
JRC44_RS25850 (26059) 26059..26208 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (26253) 26253..26312 + 60 NuclAT_0 - Antitoxin
- (26253) 26253..26312 + 60 NuclAT_0 - Antitoxin
- (26253) 26253..26312 + 60 NuclAT_0 - Antitoxin
- (26253) 26253..26312 + 60 NuclAT_0 - Antitoxin
JRC44_RS25855 (26513) 26513..26845 - 333 WP_152916585.1 hypothetical protein -
JRC44_RS25860 (26907) 26907..27506 - 600 WP_105906770.1 PIN domain-containing protein -
JRC44_RS25865 (27892) 27892..28092 - 201 WP_015059022.1 hypothetical protein -
JRC44_RS25870 (28224) 28224..28784 - 561 WP_000139328.1 fertility inhibition protein FinO -
JRC44_RS25875 (28839) 28839..29585 - 747 WP_000205770.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-55 / blaTEM-1B / fosA3 - 1..97847 97847


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T193800 WP_001312851.1 NZ_CP070300:c26208-26059 [Escherichia albertii]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

>T193800 NZ_CP093221:3734633-3734740 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 60 bp

>AT193800 NZ_CP070300:26253-26312 [Escherichia albertii]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References