Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 26236..26490 | Replicon | plasmid pESA139_2 |
Accession | NZ_CP070294 | ||
Organism | Escherichia albertii strain Sample 166 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | JRC43_RS24310 | Protein ID | WP_001312851.1 |
Coordinates | 26341..26490 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 26236..26297 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JRC43_RS24275 (21975) | 21975..22946 | + | 972 | WP_001103691.1 | plasmid segregation protein ParM | - |
JRC43_RS24280 (22951) | 22951..23343 | + | 393 | WP_000340829.1 | plasmid partitioning/stability family protein | - |
JRC43_RS24285 (23348) | 23348..24107 | - | 760 | Protein_29 | DUF4113 domain-containing protein | - |
JRC43_RS24290 (24103) | 24103..24765 | + | 663 | Protein_30 | conjugative transfer relaxase/helicase TraI | - |
JRC43_RS24295 (24758) | 24758..25312 | + | 555 | WP_208634911.1 | fertility inhibition protein FinO | - |
JRC43_RS24300 (25448) | 25448..25660 | + | 213 | WP_096949658.1 | hypothetical protein | - |
JRC43_RS24305 (25906) | 25906..25980 | + | 75 | Protein_33 | endonuclease | - |
- (26236) | 26236..26297 | - | 62 | NuclAT_0 | - | Antitoxin |
- (26236) | 26236..26297 | - | 62 | NuclAT_0 | - | Antitoxin |
- (26236) | 26236..26297 | - | 62 | NuclAT_0 | - | Antitoxin |
- (26236) | 26236..26297 | - | 62 | NuclAT_0 | - | Antitoxin |
JRC43_RS24310 (26341) | 26341..26490 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
JRC43_RS24315 (26774) | 26774..27031 | + | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
JRC43_RS25735 (27048) | 27048..27299 | - | 252 | WP_223195197.1 | replication protein RepA | - |
JRC43_RS25740 (27290) | 27290..27337 | + | 48 | WP_229471593.1 | hypothetical protein | - |
JRC43_RS24325 (27330) | 27330..27812 | + | 483 | WP_001273588.1 | hypothetical protein | - |
JRC43_RS24330 (27805) | 27805..28374 | + | 570 | Protein_39 | plasmid replication initiator RepA | - |
JRC43_RS24335 (28484) | 28484..28753 | + | 270 | WP_000079946.1 | type II toxin-antitoxin system antitoxin YacA | - |
JRC43_RS24340 (28753) | 28753..29031 | + | 279 | WP_001384452.1 | type II toxin-antitoxin system toxin YacB | - |
JRC43_RS24345 (29077) | 29077..29502 | + | 426 | Protein_42 | 3'-5' exonuclease | - |
JRC43_RS24350 (29667) | 29667..30191 | + | 525 | WP_000823671.1 | superoxide dismutase family protein | - |
JRC43_RS24355 (30453) | 30453..30878 | + | 426 | WP_000422741.1 | transposase | - |
JRC43_RS24360 (30875) | 30875..31225 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | cofA | 1..85397 | 85397 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T193760 WP_001312851.1 NZ_CP070294:26341-26490 [Escherichia albertii]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T193760 NZ_CP093208:2006490-2006678 [Staphylococcus epidermidis]
ATGAGCTTACATTTCCAAATTTTGCTGTGGCTTTCTATCTTATTTATCATCGCAGGAACGATATTATTGGTAACAATGCT
TAAAACTAAAAAAGAAGAACGAAAAGAATCTTATCTAGGCTTTACTGTAATTTTCTTAATCTTTGGTTTTGCCATCTTAA
TTTATACTTTTATATTCGGAATTTTATAA
ATGAGCTTACATTTCCAAATTTTGCTGTGGCTTTCTATCTTATTTATCATCGCAGGAACGATATTATTGGTAACAATGCT
TAAAACTAAAAAAGAAGAACGAAAAGAATCTTATCTAGGCTTTACTGTAATTTTCTTAATCTTTGGTTTTGCCATCTTAA
TTTATACTTTTATATTCGGAATTTTATAA
Antitoxin
Download Length: 62 bp
>AT193760 NZ_CP070294:c26297-26236 [Escherichia albertii]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|