Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2957086..2957311 Replicon chromosome
Accession NZ_CP070287
Organism Escherichia albertii strain Sample 168

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag JRC45_RS14650 Protein ID WP_000813254.1
Coordinates 2957086..2957241 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2957253..2957311 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JRC45_RS14600 2952117..2952302 - 186 WP_001228685.1 Rz1 family lipoprotein -
JRC45_RS14605 2952519..2953052 - 534 WP_001274714.1 lysozyme -
JRC45_RS14610 2953108..2953422 - 315 WP_097430261.1 DUF1327 domain-containing protein -
JRC45_RS14615 2953427..2953642 - 216 WP_000839572.1 class II holin family protein -
JRC45_RS14630 2954384..2955205 - 822 WP_025237241.1 antitermination protein -
JRC45_RS14635 2955202..2955582 - 381 WP_102204096.1 RusA family crossover junction endodeoxyribonuclease -
JRC45_RS14640 2955583..2956638 - 1056 WP_204628613.1 DUF968 domain-containing protein -
JRC45_RS14645 2956640..2956918 - 279 WP_001429486.1 hypothetical protein -
JRC45_RS14650 2957086..2957241 - 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
- 2957253..2957311 + 59 - - Antitoxin
JRC45_RS14655 2957488..2957592 - 105 WP_001278454.1 hypothetical protein -
JRC45_RS24595 2957708..2957896 - 189 WP_001496105.1 DUF551 domain-containing protein -
JRC45_RS24600 2958146..2958595 - 450 Protein_2908 DUF551 domain-containing protein -
JRC45_RS14665 2958606..2958869 - 264 WP_000224233.1 hypothetical protein -
JRC45_RS14670 2958871..2959088 - 218 Protein_2910 DUF4014 family protein -
JRC45_RS14675 2959121..2959333 - 213 WP_001504537.1 hypothetical protein -
JRC45_RS14680 2959380..2959736 - 357 WP_021527610.1 hypothetical protein -
JRC45_RS14685 2959714..2960214 - 501 WP_167568999.1 DUF977 family protein -
JRC45_RS14690 2960255..2961220 - 966 WP_059225150.1 hypothetical protein -
JRC45_RS14695 2961242..2961667 - 426 WP_023307884.1 toxin YdaT family protein -
JRC45_RS14700 2961651..2961923 - 273 WP_024227557.1 YdaS family helix-turn-helix protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T193688 WP_000813254.1 NZ_CP070287:c2957241-2957086 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

>T193688 NZ_CP093153:139113-139262 [Klebsiella pneumoniae]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin


Download         Length: 59 bp

>AT193688 NZ_CP070287:2957253-2957311 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References