Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1694409..1694630 Replicon chromosome
Accession NZ_CP070162
Organism Escherichia coli strain FDAARGOS_1283

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag I6K13_RS08165 Protein ID WP_000170963.1
Coordinates 1694409..1694516 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1694564..1694630 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I6K13_RS08140 (1690253) 1690253..1691335 + 1083 WP_000804726.1 peptide chain release factor 1 -
I6K13_RS08145 (1691335) 1691335..1692168 + 834 WP_000456474.1 peptide chain release factor N(5)-glutamine methyltransferase -
I6K13_RS08150 (1692165) 1692165..1692557 + 393 WP_000200375.1 invasion regulator SirB2 -
I6K13_RS08155 (1692561) 1692561..1693370 + 810 WP_001257054.1 invasion regulator SirB1 -
I6K13_RS08160 (1693406) 1693406..1694260 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
I6K13_RS08165 (1694409) 1694409..1694516 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1694566) 1694566..1694629 + 64 NuclAT_12 - -
- (1694566) 1694566..1694629 + 64 NuclAT_12 - -
- (1694566) 1694566..1694629 + 64 NuclAT_12 - -
- (1694566) 1694566..1694629 + 64 NuclAT_12 - -
- (1694566) 1694566..1694629 + 64 NuclAT_13 - -
- (1694566) 1694566..1694629 + 64 NuclAT_13 - -
- (1694566) 1694566..1694629 + 64 NuclAT_13 - -
- (1694566) 1694566..1694629 + 64 NuclAT_13 - -
- (1694566) 1694566..1694629 + 64 NuclAT_14 - -
- (1694566) 1694566..1694629 + 64 NuclAT_14 - -
- (1694566) 1694566..1694629 + 64 NuclAT_14 - -
- (1694566) 1694566..1694629 + 64 NuclAT_14 - -
- (1694566) 1694566..1694629 + 64 NuclAT_15 - -
- (1694566) 1694566..1694629 + 64 NuclAT_15 - -
- (1694566) 1694566..1694629 + 64 NuclAT_15 - -
- (1694566) 1694566..1694629 + 64 NuclAT_15 - -
- (1694566) 1694566..1694629 + 64 NuclAT_16 - -
- (1694566) 1694566..1694629 + 64 NuclAT_16 - -
- (1694566) 1694566..1694629 + 64 NuclAT_16 - -
- (1694566) 1694566..1694629 + 64 NuclAT_16 - -
- (1694566) 1694566..1694629 + 64 NuclAT_17 - -
- (1694566) 1694566..1694629 + 64 NuclAT_17 - -
- (1694566) 1694566..1694629 + 64 NuclAT_17 - -
- (1694566) 1694566..1694629 + 64 NuclAT_17 - -
- (1694564) 1694564..1694630 + 67 NuclAT_10 - Antitoxin
- (1694564) 1694564..1694630 + 67 NuclAT_10 - Antitoxin
- (1694564) 1694564..1694630 + 67 NuclAT_10 - Antitoxin
- (1694564) 1694564..1694630 + 67 NuclAT_10 - Antitoxin
- (1694564) 1694564..1694630 + 67 NuclAT_11 - Antitoxin
- (1694564) 1694564..1694630 + 67 NuclAT_11 - Antitoxin
- (1694564) 1694564..1694630 + 67 NuclAT_11 - Antitoxin
- (1694564) 1694564..1694630 + 67 NuclAT_11 - Antitoxin
- (1694564) 1694564..1694630 + 67 NuclAT_6 - Antitoxin
- (1694564) 1694564..1694630 + 67 NuclAT_6 - Antitoxin
- (1694564) 1694564..1694630 + 67 NuclAT_6 - Antitoxin
- (1694564) 1694564..1694630 + 67 NuclAT_6 - Antitoxin
- (1694564) 1694564..1694630 + 67 NuclAT_7 - Antitoxin
- (1694564) 1694564..1694630 + 67 NuclAT_7 - Antitoxin
- (1694564) 1694564..1694630 + 67 NuclAT_7 - Antitoxin
- (1694564) 1694564..1694630 + 67 NuclAT_7 - Antitoxin
- (1694564) 1694564..1694630 + 67 NuclAT_8 - Antitoxin
- (1694564) 1694564..1694630 + 67 NuclAT_8 - Antitoxin
- (1694564) 1694564..1694630 + 67 NuclAT_8 - Antitoxin
- (1694564) 1694564..1694630 + 67 NuclAT_8 - Antitoxin
- (1694564) 1694564..1694630 + 67 NuclAT_9 - Antitoxin
- (1694564) 1694564..1694630 + 67 NuclAT_9 - Antitoxin
- (1694564) 1694564..1694630 + 67 NuclAT_9 - Antitoxin
- (1694564) 1694564..1694630 + 67 NuclAT_9 - Antitoxin
- (1694566) 1694566..1694631 + 66 NuclAT_19 - -
- (1694566) 1694566..1694631 + 66 NuclAT_19 - -
- (1694566) 1694566..1694631 + 66 NuclAT_19 - -
- (1694566) 1694566..1694631 + 66 NuclAT_19 - -
- (1694566) 1694566..1694631 + 66 NuclAT_20 - -
- (1694566) 1694566..1694631 + 66 NuclAT_20 - -
- (1694566) 1694566..1694631 + 66 NuclAT_20 - -
- (1694566) 1694566..1694631 + 66 NuclAT_20 - -
- (1694566) 1694566..1694631 + 66 NuclAT_21 - -
- (1694566) 1694566..1694631 + 66 NuclAT_21 - -
- (1694566) 1694566..1694631 + 66 NuclAT_21 - -
- (1694566) 1694566..1694631 + 66 NuclAT_21 - -
- (1694566) 1694566..1694631 + 66 NuclAT_22 - -
- (1694566) 1694566..1694631 + 66 NuclAT_22 - -
- (1694566) 1694566..1694631 + 66 NuclAT_22 - -
- (1694566) 1694566..1694631 + 66 NuclAT_22 - -
- (1694566) 1694566..1694631 + 66 NuclAT_24 - -
- (1694566) 1694566..1694631 + 66 NuclAT_24 - -
- (1694566) 1694566..1694631 + 66 NuclAT_24 - -
- (1694566) 1694566..1694631 + 66 NuclAT_24 - -
- (1694566) 1694566..1694631 + 66 NuclAT_25 - -
- (1694566) 1694566..1694631 + 66 NuclAT_25 - -
- (1694566) 1694566..1694631 + 66 NuclAT_25 - -
- (1694566) 1694566..1694631 + 66 NuclAT_25 - -
I6K13_RS08170 (1694921) 1694921..1696021 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
I6K13_RS08175 (1696291) 1696291..1696521 + 231 WP_001146444.1 putative cation transport regulator ChaB -
I6K13_RS08180 (1696679) 1696679..1697374 + 696 WP_113263527.1 glutathione-specific gamma-glutamylcyclotransferase -
I6K13_RS08185 (1697418) 1697418..1697771 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
I6K13_RS08190 (1697956) 1697956..1699350 + 1395 WP_000086188.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T193421 WP_000170963.1 NZ_CP070162:c1694516-1694409 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T193421 NZ_CP092969:c189970-189569 [Methylocystis parvus OBBP]
TTGACCCGCTATTTGCTGGACACGAACATCATTTCCGATTTGATCAGGAACCCGAAAGGCAAGGTGGCGAAGCACATAGC
CCGAGTGGGCGAGAAAAACGTGTGCACGAGCATCATCGTGGCCGCCGAGCTTCGATATGGCTGCGCGAAGAGCGGCTCGA
AACGGCTCTTGGAGGCGGTCGAGCTCCTGCTGGGAGAGCTGGACGTCCTGTCTTTGGAGGCGCCTGCCGATGCGGAATAT
GGGAGGATTCGCGCCGAGCTGGAACGGAAGGGAAGCCCAATCGGGGGGAATGATTTGCTGATTGCGGCCCATGCTCTGGC
GATCGAAGCAACGATGGTAACCGCCAATGTGGACGAGTTCACCCGAGTTAAGGGGCTGAAAGTGCAAAACTGGCTTTTGT
GA

Antitoxin


Download         Length: 67 bp

>AT193421 NZ_CP070162:1694564-1694630 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References