Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-orzP/Ldr(toxin) |
| Location | 4781305..4781525 | Replicon | chromosome |
| Accession | NZ_CP070152 | ||
| Organism | Escherichia coli strain FDAARGOS_1285 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A1D7PZ30 |
| Locus tag | I6K15_RS23230 | Protein ID | WP_022645587.1 |
| Coordinates | 4781305..4781412 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | orzP | ||
| Locus tag | - | ||
| Coordinates | 4781460..4781525 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I6K15_RS23205 (4777149) | 4777149..4778231 | + | 1083 | WP_128277936.1 | peptide chain release factor 1 | - |
| I6K15_RS23210 (4778231) | 4778231..4779064 | + | 834 | WP_022645585.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| I6K15_RS23215 (4779061) | 4779061..4779453 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| I6K15_RS23220 (4779457) | 4779457..4780266 | + | 810 | WP_022645586.1 | invasion regulator SirB1 | - |
| I6K15_RS23225 (4780302) | 4780302..4781156 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| I6K15_RS23230 (4781305) | 4781305..4781412 | - | 108 | WP_022645587.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (4781460) | 4781460..4781525 | + | 66 | NuclAT_11 | - | Antitoxin |
| - (4781460) | 4781460..4781525 | + | 66 | NuclAT_11 | - | Antitoxin |
| - (4781460) | 4781460..4781525 | + | 66 | NuclAT_11 | - | Antitoxin |
| - (4781460) | 4781460..4781525 | + | 66 | NuclAT_11 | - | Antitoxin |
| - (4781460) | 4781460..4781525 | + | 66 | NuclAT_13 | - | Antitoxin |
| - (4781460) | 4781460..4781525 | + | 66 | NuclAT_13 | - | Antitoxin |
| - (4781460) | 4781460..4781525 | + | 66 | NuclAT_13 | - | Antitoxin |
| - (4781460) | 4781460..4781525 | + | 66 | NuclAT_13 | - | Antitoxin |
| - (4781460) | 4781460..4781525 | + | 66 | NuclAT_15 | - | Antitoxin |
| - (4781460) | 4781460..4781525 | + | 66 | NuclAT_15 | - | Antitoxin |
| - (4781460) | 4781460..4781525 | + | 66 | NuclAT_15 | - | Antitoxin |
| - (4781460) | 4781460..4781525 | + | 66 | NuclAT_15 | - | Antitoxin |
| - (4781460) | 4781460..4781525 | + | 66 | NuclAT_17 | - | Antitoxin |
| - (4781460) | 4781460..4781525 | + | 66 | NuclAT_17 | - | Antitoxin |
| - (4781460) | 4781460..4781525 | + | 66 | NuclAT_17 | - | Antitoxin |
| - (4781460) | 4781460..4781525 | + | 66 | NuclAT_17 | - | Antitoxin |
| - (4781460) | 4781460..4781525 | + | 66 | NuclAT_19 | - | Antitoxin |
| - (4781460) | 4781460..4781525 | + | 66 | NuclAT_19 | - | Antitoxin |
| - (4781460) | 4781460..4781525 | + | 66 | NuclAT_19 | - | Antitoxin |
| - (4781460) | 4781460..4781525 | + | 66 | NuclAT_19 | - | Antitoxin |
| - (4781460) | 4781460..4781525 | + | 66 | NuclAT_21 | - | Antitoxin |
| - (4781460) | 4781460..4781525 | + | 66 | NuclAT_21 | - | Antitoxin |
| - (4781460) | 4781460..4781525 | + | 66 | NuclAT_21 | - | Antitoxin |
| - (4781460) | 4781460..4781525 | + | 66 | NuclAT_21 | - | Antitoxin |
| - (4781462) | 4781462..4781526 | + | 65 | NuclAT_24 | - | - |
| - (4781462) | 4781462..4781526 | + | 65 | NuclAT_24 | - | - |
| - (4781462) | 4781462..4781526 | + | 65 | NuclAT_24 | - | - |
| - (4781462) | 4781462..4781526 | + | 65 | NuclAT_24 | - | - |
| - (4781462) | 4781462..4781526 | + | 65 | NuclAT_26 | - | - |
| - (4781462) | 4781462..4781526 | + | 65 | NuclAT_26 | - | - |
| - (4781462) | 4781462..4781526 | + | 65 | NuclAT_26 | - | - |
| - (4781462) | 4781462..4781526 | + | 65 | NuclAT_26 | - | - |
| - (4781462) | 4781462..4781526 | + | 65 | NuclAT_28 | - | - |
| - (4781462) | 4781462..4781526 | + | 65 | NuclAT_28 | - | - |
| - (4781462) | 4781462..4781526 | + | 65 | NuclAT_28 | - | - |
| - (4781462) | 4781462..4781526 | + | 65 | NuclAT_28 | - | - |
| - (4781462) | 4781462..4781526 | + | 65 | NuclAT_30 | - | - |
| - (4781462) | 4781462..4781526 | + | 65 | NuclAT_30 | - | - |
| - (4781462) | 4781462..4781526 | + | 65 | NuclAT_30 | - | - |
| - (4781462) | 4781462..4781526 | + | 65 | NuclAT_30 | - | - |
| - (4781462) | 4781462..4781526 | + | 65 | NuclAT_32 | - | - |
| - (4781462) | 4781462..4781526 | + | 65 | NuclAT_32 | - | - |
| - (4781462) | 4781462..4781526 | + | 65 | NuclAT_32 | - | - |
| - (4781462) | 4781462..4781526 | + | 65 | NuclAT_32 | - | - |
| - (4781462) | 4781462..4781526 | + | 65 | NuclAT_34 | - | - |
| - (4781462) | 4781462..4781526 | + | 65 | NuclAT_34 | - | - |
| - (4781462) | 4781462..4781526 | + | 65 | NuclAT_34 | - | - |
| - (4781462) | 4781462..4781526 | + | 65 | NuclAT_34 | - | - |
| I6K15_RS23235 (4781839) | 4781839..4781946 | - | 108 | WP_000170956.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (4781999) | 4781999..4782060 | + | 62 | NuclAT_23 | - | - |
| - (4781999) | 4781999..4782060 | + | 62 | NuclAT_23 | - | - |
| - (4781999) | 4781999..4782060 | + | 62 | NuclAT_23 | - | - |
| - (4781999) | 4781999..4782060 | + | 62 | NuclAT_23 | - | - |
| - (4781999) | 4781999..4782060 | + | 62 | NuclAT_25 | - | - |
| - (4781999) | 4781999..4782060 | + | 62 | NuclAT_25 | - | - |
| - (4781999) | 4781999..4782060 | + | 62 | NuclAT_25 | - | - |
| - (4781999) | 4781999..4782060 | + | 62 | NuclAT_25 | - | - |
| - (4781999) | 4781999..4782060 | + | 62 | NuclAT_27 | - | - |
| - (4781999) | 4781999..4782060 | + | 62 | NuclAT_27 | - | - |
| - (4781999) | 4781999..4782060 | + | 62 | NuclAT_27 | - | - |
| - (4781999) | 4781999..4782060 | + | 62 | NuclAT_27 | - | - |
| - (4781999) | 4781999..4782060 | + | 62 | NuclAT_29 | - | - |
| - (4781999) | 4781999..4782060 | + | 62 | NuclAT_29 | - | - |
| - (4781999) | 4781999..4782060 | + | 62 | NuclAT_29 | - | - |
| - (4781999) | 4781999..4782060 | + | 62 | NuclAT_29 | - | - |
| - (4781999) | 4781999..4782060 | + | 62 | NuclAT_31 | - | - |
| - (4781999) | 4781999..4782060 | + | 62 | NuclAT_31 | - | - |
| - (4781999) | 4781999..4782060 | + | 62 | NuclAT_31 | - | - |
| - (4781999) | 4781999..4782060 | + | 62 | NuclAT_31 | - | - |
| - (4781999) | 4781999..4782060 | + | 62 | NuclAT_33 | - | - |
| - (4781999) | 4781999..4782060 | + | 62 | NuclAT_33 | - | - |
| - (4781999) | 4781999..4782060 | + | 62 | NuclAT_33 | - | - |
| - (4781999) | 4781999..4782060 | + | 62 | NuclAT_33 | - | - |
| - (4781999) | 4781999..4782061 | + | 63 | NuclAT_12 | - | - |
| - (4781999) | 4781999..4782061 | + | 63 | NuclAT_12 | - | - |
| - (4781999) | 4781999..4782061 | + | 63 | NuclAT_12 | - | - |
| - (4781999) | 4781999..4782061 | + | 63 | NuclAT_12 | - | - |
| - (4781999) | 4781999..4782061 | + | 63 | NuclAT_14 | - | - |
| - (4781999) | 4781999..4782061 | + | 63 | NuclAT_14 | - | - |
| - (4781999) | 4781999..4782061 | + | 63 | NuclAT_14 | - | - |
| - (4781999) | 4781999..4782061 | + | 63 | NuclAT_14 | - | - |
| - (4781999) | 4781999..4782061 | + | 63 | NuclAT_16 | - | - |
| - (4781999) | 4781999..4782061 | + | 63 | NuclAT_16 | - | - |
| - (4781999) | 4781999..4782061 | + | 63 | NuclAT_16 | - | - |
| - (4781999) | 4781999..4782061 | + | 63 | NuclAT_16 | - | - |
| - (4781999) | 4781999..4782061 | + | 63 | NuclAT_18 | - | - |
| - (4781999) | 4781999..4782061 | + | 63 | NuclAT_18 | - | - |
| - (4781999) | 4781999..4782061 | + | 63 | NuclAT_18 | - | - |
| - (4781999) | 4781999..4782061 | + | 63 | NuclAT_18 | - | - |
| - (4781999) | 4781999..4782061 | + | 63 | NuclAT_20 | - | - |
| - (4781999) | 4781999..4782061 | + | 63 | NuclAT_20 | - | - |
| - (4781999) | 4781999..4782061 | + | 63 | NuclAT_20 | - | - |
| - (4781999) | 4781999..4782061 | + | 63 | NuclAT_20 | - | - |
| - (4781999) | 4781999..4782061 | + | 63 | NuclAT_22 | - | - |
| - (4781999) | 4781999..4782061 | + | 63 | NuclAT_22 | - | - |
| - (4781999) | 4781999..4782061 | + | 63 | NuclAT_22 | - | - |
| - (4781999) | 4781999..4782061 | + | 63 | NuclAT_22 | - | - |
| - (4781999) | 4781999..4782062 | + | 64 | NuclAT_35 | - | - |
| - (4781999) | 4781999..4782062 | + | 64 | NuclAT_35 | - | - |
| - (4781999) | 4781999..4782062 | + | 64 | NuclAT_35 | - | - |
| - (4781999) | 4781999..4782062 | + | 64 | NuclAT_35 | - | - |
| - (4781999) | 4781999..4782062 | + | 64 | NuclAT_36 | - | - |
| - (4781999) | 4781999..4782062 | + | 64 | NuclAT_36 | - | - |
| - (4781999) | 4781999..4782062 | + | 64 | NuclAT_36 | - | - |
| - (4781999) | 4781999..4782062 | + | 64 | NuclAT_36 | - | - |
| - (4781999) | 4781999..4782062 | + | 64 | NuclAT_37 | - | - |
| - (4781999) | 4781999..4782062 | + | 64 | NuclAT_37 | - | - |
| - (4781999) | 4781999..4782062 | + | 64 | NuclAT_37 | - | - |
| - (4781999) | 4781999..4782062 | + | 64 | NuclAT_37 | - | - |
| I6K15_RS23240 (4782352) | 4782352..4783452 | - | 1101 | WP_001301956.1 | sodium-potassium/proton antiporter ChaA | - |
| I6K15_RS23245 (4783722) | 4783722..4783952 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| I6K15_RS23250 (4784110) | 4784110..4784805 | + | 696 | WP_012311798.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| I6K15_RS23255 (4784849) | 4784849..4785202 | - | 354 | WP_001169659.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4029.82 Da Isoelectric Point: 11.4779
>T193359 WP_022645587.1 NZ_CP070152:c4781412-4781305 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAVIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAVIVSWWRNRK
Download Length: 108 bp
>T193359 NZ_CP092892:c330895-330626 [Agrobacterium tumefaciens]
GTGATCTGGACAATTGAATATCACACGCTTGTCCAGAAAGAGATGCGCAAGATAAATCCGGAAACGCGCCGGCGAATCCG
GAGTTTTCTGCACGAACGATTGGCGGCATTGGATGATCCACGCCAGACCGGCGCCGCCCTGCAAGGCTCCGAACTCGGAA
ATTTCTGGCGCTACCGGGTGGGCGATTACCGCATCATCTGCGATATACAGGATCACAAGCTCGTCGTGCTGGTGGTCGAA
ATCGGCCATCGCCGTGAAATCTACCGATAG
GTGATCTGGACAATTGAATATCACACGCTTGTCCAGAAAGAGATGCGCAAGATAAATCCGGAAACGCGCCGGCGAATCCG
GAGTTTTCTGCACGAACGATTGGCGGCATTGGATGATCCACGCCAGACCGGCGCCGCCCTGCAAGGCTCCGAACTCGGAA
ATTTCTGGCGCTACCGGGTGGGCGATTACCGCATCATCTGCGATATACAGGATCACAAGCTCGTCGTGCTGGTGGTCGAA
ATCGGCCATCGCCGTGAAATCTACCGATAG
Antitoxin
Download Length: 66 bp
>AT193359 NZ_CP070152:4781460-4781525 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGGTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGGTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|