Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-orzP/Ldr(toxin)
Location 4781305..4781525 Replicon chromosome
Accession NZ_CP070152
Organism Escherichia coli strain FDAARGOS_1285

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1D7PZ30
Locus tag I6K15_RS23230 Protein ID WP_022645587.1
Coordinates 4781305..4781412 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name orzP
Locus tag -
Coordinates 4781460..4781525 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I6K15_RS23205 (4777149) 4777149..4778231 + 1083 WP_128277936.1 peptide chain release factor 1 -
I6K15_RS23210 (4778231) 4778231..4779064 + 834 WP_022645585.1 peptide chain release factor N(5)-glutamine methyltransferase -
I6K15_RS23215 (4779061) 4779061..4779453 + 393 WP_000200374.1 invasion regulator SirB2 -
I6K15_RS23220 (4779457) 4779457..4780266 + 810 WP_022645586.1 invasion regulator SirB1 -
I6K15_RS23225 (4780302) 4780302..4781156 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
I6K15_RS23230 (4781305) 4781305..4781412 - 108 WP_022645587.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4781460) 4781460..4781525 + 66 NuclAT_11 - Antitoxin
- (4781460) 4781460..4781525 + 66 NuclAT_11 - Antitoxin
- (4781460) 4781460..4781525 + 66 NuclAT_11 - Antitoxin
- (4781460) 4781460..4781525 + 66 NuclAT_11 - Antitoxin
- (4781460) 4781460..4781525 + 66 NuclAT_13 - Antitoxin
- (4781460) 4781460..4781525 + 66 NuclAT_13 - Antitoxin
- (4781460) 4781460..4781525 + 66 NuclAT_13 - Antitoxin
- (4781460) 4781460..4781525 + 66 NuclAT_13 - Antitoxin
- (4781460) 4781460..4781525 + 66 NuclAT_15 - Antitoxin
- (4781460) 4781460..4781525 + 66 NuclAT_15 - Antitoxin
- (4781460) 4781460..4781525 + 66 NuclAT_15 - Antitoxin
- (4781460) 4781460..4781525 + 66 NuclAT_15 - Antitoxin
- (4781460) 4781460..4781525 + 66 NuclAT_17 - Antitoxin
- (4781460) 4781460..4781525 + 66 NuclAT_17 - Antitoxin
- (4781460) 4781460..4781525 + 66 NuclAT_17 - Antitoxin
- (4781460) 4781460..4781525 + 66 NuclAT_17 - Antitoxin
- (4781460) 4781460..4781525 + 66 NuclAT_19 - Antitoxin
- (4781460) 4781460..4781525 + 66 NuclAT_19 - Antitoxin
- (4781460) 4781460..4781525 + 66 NuclAT_19 - Antitoxin
- (4781460) 4781460..4781525 + 66 NuclAT_19 - Antitoxin
- (4781460) 4781460..4781525 + 66 NuclAT_21 - Antitoxin
- (4781460) 4781460..4781525 + 66 NuclAT_21 - Antitoxin
- (4781460) 4781460..4781525 + 66 NuclAT_21 - Antitoxin
- (4781460) 4781460..4781525 + 66 NuclAT_21 - Antitoxin
- (4781462) 4781462..4781526 + 65 NuclAT_24 - -
- (4781462) 4781462..4781526 + 65 NuclAT_24 - -
- (4781462) 4781462..4781526 + 65 NuclAT_24 - -
- (4781462) 4781462..4781526 + 65 NuclAT_24 - -
- (4781462) 4781462..4781526 + 65 NuclAT_26 - -
- (4781462) 4781462..4781526 + 65 NuclAT_26 - -
- (4781462) 4781462..4781526 + 65 NuclAT_26 - -
- (4781462) 4781462..4781526 + 65 NuclAT_26 - -
- (4781462) 4781462..4781526 + 65 NuclAT_28 - -
- (4781462) 4781462..4781526 + 65 NuclAT_28 - -
- (4781462) 4781462..4781526 + 65 NuclAT_28 - -
- (4781462) 4781462..4781526 + 65 NuclAT_28 - -
- (4781462) 4781462..4781526 + 65 NuclAT_30 - -
- (4781462) 4781462..4781526 + 65 NuclAT_30 - -
- (4781462) 4781462..4781526 + 65 NuclAT_30 - -
- (4781462) 4781462..4781526 + 65 NuclAT_30 - -
- (4781462) 4781462..4781526 + 65 NuclAT_32 - -
- (4781462) 4781462..4781526 + 65 NuclAT_32 - -
- (4781462) 4781462..4781526 + 65 NuclAT_32 - -
- (4781462) 4781462..4781526 + 65 NuclAT_32 - -
- (4781462) 4781462..4781526 + 65 NuclAT_34 - -
- (4781462) 4781462..4781526 + 65 NuclAT_34 - -
- (4781462) 4781462..4781526 + 65 NuclAT_34 - -
- (4781462) 4781462..4781526 + 65 NuclAT_34 - -
I6K15_RS23235 (4781839) 4781839..4781946 - 108 WP_000170956.1 type I toxin-antitoxin system toxin Ldr family protein -
- (4781999) 4781999..4782060 + 62 NuclAT_23 - -
- (4781999) 4781999..4782060 + 62 NuclAT_23 - -
- (4781999) 4781999..4782060 + 62 NuclAT_23 - -
- (4781999) 4781999..4782060 + 62 NuclAT_23 - -
- (4781999) 4781999..4782060 + 62 NuclAT_25 - -
- (4781999) 4781999..4782060 + 62 NuclAT_25 - -
- (4781999) 4781999..4782060 + 62 NuclAT_25 - -
- (4781999) 4781999..4782060 + 62 NuclAT_25 - -
- (4781999) 4781999..4782060 + 62 NuclAT_27 - -
- (4781999) 4781999..4782060 + 62 NuclAT_27 - -
- (4781999) 4781999..4782060 + 62 NuclAT_27 - -
- (4781999) 4781999..4782060 + 62 NuclAT_27 - -
- (4781999) 4781999..4782060 + 62 NuclAT_29 - -
- (4781999) 4781999..4782060 + 62 NuclAT_29 - -
- (4781999) 4781999..4782060 + 62 NuclAT_29 - -
- (4781999) 4781999..4782060 + 62 NuclAT_29 - -
- (4781999) 4781999..4782060 + 62 NuclAT_31 - -
- (4781999) 4781999..4782060 + 62 NuclAT_31 - -
- (4781999) 4781999..4782060 + 62 NuclAT_31 - -
- (4781999) 4781999..4782060 + 62 NuclAT_31 - -
- (4781999) 4781999..4782060 + 62 NuclAT_33 - -
- (4781999) 4781999..4782060 + 62 NuclAT_33 - -
- (4781999) 4781999..4782060 + 62 NuclAT_33 - -
- (4781999) 4781999..4782060 + 62 NuclAT_33 - -
- (4781999) 4781999..4782061 + 63 NuclAT_12 - -
- (4781999) 4781999..4782061 + 63 NuclAT_12 - -
- (4781999) 4781999..4782061 + 63 NuclAT_12 - -
- (4781999) 4781999..4782061 + 63 NuclAT_12 - -
- (4781999) 4781999..4782061 + 63 NuclAT_14 - -
- (4781999) 4781999..4782061 + 63 NuclAT_14 - -
- (4781999) 4781999..4782061 + 63 NuclAT_14 - -
- (4781999) 4781999..4782061 + 63 NuclAT_14 - -
- (4781999) 4781999..4782061 + 63 NuclAT_16 - -
- (4781999) 4781999..4782061 + 63 NuclAT_16 - -
- (4781999) 4781999..4782061 + 63 NuclAT_16 - -
- (4781999) 4781999..4782061 + 63 NuclAT_16 - -
- (4781999) 4781999..4782061 + 63 NuclAT_18 - -
- (4781999) 4781999..4782061 + 63 NuclAT_18 - -
- (4781999) 4781999..4782061 + 63 NuclAT_18 - -
- (4781999) 4781999..4782061 + 63 NuclAT_18 - -
- (4781999) 4781999..4782061 + 63 NuclAT_20 - -
- (4781999) 4781999..4782061 + 63 NuclAT_20 - -
- (4781999) 4781999..4782061 + 63 NuclAT_20 - -
- (4781999) 4781999..4782061 + 63 NuclAT_20 - -
- (4781999) 4781999..4782061 + 63 NuclAT_22 - -
- (4781999) 4781999..4782061 + 63 NuclAT_22 - -
- (4781999) 4781999..4782061 + 63 NuclAT_22 - -
- (4781999) 4781999..4782061 + 63 NuclAT_22 - -
- (4781999) 4781999..4782062 + 64 NuclAT_35 - -
- (4781999) 4781999..4782062 + 64 NuclAT_35 - -
- (4781999) 4781999..4782062 + 64 NuclAT_35 - -
- (4781999) 4781999..4782062 + 64 NuclAT_35 - -
- (4781999) 4781999..4782062 + 64 NuclAT_36 - -
- (4781999) 4781999..4782062 + 64 NuclAT_36 - -
- (4781999) 4781999..4782062 + 64 NuclAT_36 - -
- (4781999) 4781999..4782062 + 64 NuclAT_36 - -
- (4781999) 4781999..4782062 + 64 NuclAT_37 - -
- (4781999) 4781999..4782062 + 64 NuclAT_37 - -
- (4781999) 4781999..4782062 + 64 NuclAT_37 - -
- (4781999) 4781999..4782062 + 64 NuclAT_37 - -
I6K15_RS23240 (4782352) 4782352..4783452 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
I6K15_RS23245 (4783722) 4783722..4783952 + 231 WP_001146444.1 putative cation transport regulator ChaB -
I6K15_RS23250 (4784110) 4784110..4784805 + 696 WP_012311798.1 glutathione-specific gamma-glutamylcyclotransferase -
I6K15_RS23255 (4784849) 4784849..4785202 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4029.82 Da        Isoelectric Point: 11.4779

>T193359 WP_022645587.1 NZ_CP070152:c4781412-4781305 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T193359 NZ_CP092892:c330895-330626 [Agrobacterium tumefaciens]
GTGATCTGGACAATTGAATATCACACGCTTGTCCAGAAAGAGATGCGCAAGATAAATCCGGAAACGCGCCGGCGAATCCG
GAGTTTTCTGCACGAACGATTGGCGGCATTGGATGATCCACGCCAGACCGGCGCCGCCCTGCAAGGCTCCGAACTCGGAA
ATTTCTGGCGCTACCGGGTGGGCGATTACCGCATCATCTGCGATATACAGGATCACAAGCTCGTCGTGCTGGTGGTCGAA
ATCGGCCATCGCCGTGAAATCTACCGATAG

Antitoxin


Download         Length: 66 bp

>AT193359 NZ_CP070152:4781460-4781525 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGGTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1D7PZ30

Antitoxin

Download structure file

References