Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1891240..1891461 Replicon chromosome
Accession NZ_CP070148
Organism Escherichia coli strain FDAARGOS_1297

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag I6K27_RS09125 Protein ID WP_000170954.1
Coordinates 1891240..1891347 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1891400..1891461 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I6K27_RS09100 (1887085) 1887085..1888167 + 1083 WP_000804726.1 peptide chain release factor 1 -
I6K27_RS09105 (1888167) 1888167..1889000 + 834 WP_000456474.1 peptide chain release factor N(5)-glutamine methyltransferase -
I6K27_RS09110 (1888997) 1888997..1889389 + 393 WP_000200375.1 invasion regulator SirB2 -
I6K27_RS09115 (1889393) 1889393..1890202 + 810 WP_001257054.1 invasion regulator SirB1 -
I6K27_RS09120 (1890238) 1890238..1891092 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
I6K27_RS09125 (1891240) 1891240..1891347 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1891400) 1891400..1891461 + 62 NuclAT_12 - Antitoxin
- (1891400) 1891400..1891461 + 62 NuclAT_12 - Antitoxin
- (1891400) 1891400..1891461 + 62 NuclAT_12 - Antitoxin
- (1891400) 1891400..1891461 + 62 NuclAT_12 - Antitoxin
- (1891400) 1891400..1891461 + 62 NuclAT_13 - Antitoxin
- (1891400) 1891400..1891461 + 62 NuclAT_13 - Antitoxin
- (1891400) 1891400..1891461 + 62 NuclAT_13 - Antitoxin
- (1891400) 1891400..1891461 + 62 NuclAT_13 - Antitoxin
- (1891400) 1891400..1891461 + 62 NuclAT_14 - Antitoxin
- (1891400) 1891400..1891461 + 62 NuclAT_14 - Antitoxin
- (1891400) 1891400..1891461 + 62 NuclAT_14 - Antitoxin
- (1891400) 1891400..1891461 + 62 NuclAT_14 - Antitoxin
- (1891400) 1891400..1891461 + 62 NuclAT_15 - Antitoxin
- (1891400) 1891400..1891461 + 62 NuclAT_15 - Antitoxin
- (1891400) 1891400..1891461 + 62 NuclAT_15 - Antitoxin
- (1891400) 1891400..1891461 + 62 NuclAT_15 - Antitoxin
- (1891400) 1891400..1891461 + 62 NuclAT_16 - Antitoxin
- (1891400) 1891400..1891461 + 62 NuclAT_16 - Antitoxin
- (1891400) 1891400..1891461 + 62 NuclAT_16 - Antitoxin
- (1891400) 1891400..1891461 + 62 NuclAT_16 - Antitoxin
- (1891400) 1891400..1891461 + 62 NuclAT_17 - Antitoxin
- (1891400) 1891400..1891461 + 62 NuclAT_17 - Antitoxin
- (1891400) 1891400..1891461 + 62 NuclAT_17 - Antitoxin
- (1891400) 1891400..1891461 + 62 NuclAT_17 - Antitoxin
- (1891400) 1891400..1891462 + 63 NuclAT_10 - -
- (1891400) 1891400..1891462 + 63 NuclAT_10 - -
- (1891400) 1891400..1891462 + 63 NuclAT_10 - -
- (1891400) 1891400..1891462 + 63 NuclAT_10 - -
- (1891400) 1891400..1891462 + 63 NuclAT_11 - -
- (1891400) 1891400..1891462 + 63 NuclAT_11 - -
- (1891400) 1891400..1891462 + 63 NuclAT_11 - -
- (1891400) 1891400..1891462 + 63 NuclAT_11 - -
- (1891400) 1891400..1891462 + 63 NuclAT_6 - -
- (1891400) 1891400..1891462 + 63 NuclAT_6 - -
- (1891400) 1891400..1891462 + 63 NuclAT_6 - -
- (1891400) 1891400..1891462 + 63 NuclAT_6 - -
- (1891400) 1891400..1891462 + 63 NuclAT_7 - -
- (1891400) 1891400..1891462 + 63 NuclAT_7 - -
- (1891400) 1891400..1891462 + 63 NuclAT_7 - -
- (1891400) 1891400..1891462 + 63 NuclAT_7 - -
- (1891400) 1891400..1891462 + 63 NuclAT_8 - -
- (1891400) 1891400..1891462 + 63 NuclAT_8 - -
- (1891400) 1891400..1891462 + 63 NuclAT_8 - -
- (1891400) 1891400..1891462 + 63 NuclAT_8 - -
- (1891400) 1891400..1891462 + 63 NuclAT_9 - -
- (1891400) 1891400..1891462 + 63 NuclAT_9 - -
- (1891400) 1891400..1891462 + 63 NuclAT_9 - -
- (1891400) 1891400..1891462 + 63 NuclAT_9 - -
- (1891400) 1891400..1891463 + 64 NuclAT_18 - -
- (1891400) 1891400..1891463 + 64 NuclAT_18 - -
- (1891400) 1891400..1891463 + 64 NuclAT_18 - -
- (1891400) 1891400..1891463 + 64 NuclAT_18 - -
- (1891400) 1891400..1891463 + 64 NuclAT_19 - -
- (1891400) 1891400..1891463 + 64 NuclAT_19 - -
- (1891400) 1891400..1891463 + 64 NuclAT_19 - -
- (1891400) 1891400..1891463 + 64 NuclAT_19 - -
- (1891400) 1891400..1891463 + 64 NuclAT_20 - -
- (1891400) 1891400..1891463 + 64 NuclAT_20 - -
- (1891400) 1891400..1891463 + 64 NuclAT_20 - -
- (1891400) 1891400..1891463 + 64 NuclAT_20 - -
- (1891400) 1891400..1891463 + 64 NuclAT_21 - -
- (1891400) 1891400..1891463 + 64 NuclAT_21 - -
- (1891400) 1891400..1891463 + 64 NuclAT_21 - -
- (1891400) 1891400..1891463 + 64 NuclAT_21 - -
- (1891400) 1891400..1891463 + 64 NuclAT_22 - -
- (1891400) 1891400..1891463 + 64 NuclAT_22 - -
- (1891400) 1891400..1891463 + 64 NuclAT_22 - -
- (1891400) 1891400..1891463 + 64 NuclAT_22 - -
- (1891400) 1891400..1891463 + 64 NuclAT_23 - -
- (1891400) 1891400..1891463 + 64 NuclAT_23 - -
- (1891400) 1891400..1891463 + 64 NuclAT_23 - -
- (1891400) 1891400..1891463 + 64 NuclAT_23 - -
I6K27_RS09130 (1891753) 1891753..1892853 - 1101 WP_001313768.1 sodium-potassium/proton antiporter ChaA -
I6K27_RS09135 (1893123) 1893123..1893353 + 231 WP_001146444.1 putative cation transport regulator ChaB -
I6K27_RS09140 (1893511) 1893511..1894206 + 696 WP_000632706.1 glutathione-specific gamma-glutamylcyclotransferase -
I6K27_RS09145 (1894250) 1894250..1894603 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
I6K27_RS09150 (1894788) 1894788..1896182 + 1395 WP_000086194.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T193315 WP_000170954.1 NZ_CP070148:c1891347-1891240 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T193315 NZ_CP092852:1338435-1338752 [Burkholderia contaminans]
ATGCCCTACAGTGCGCCTACGTTCAGCATCCGGACCACCGGCGTCTTCGACACCTGGTTTGCCGGCCTGCAGGATCGCGT
CGCGAAGCGCCGCATCCAGGCACGCATCGACCGCCTCTCGATGGGCAATCCGGGCGACTGGAAGTCCGCCGGCTCGCCGG
TCGTCGAGATGCGGATCGACCACGGCCCGGGCTATCGCGTCTACTACGTCCGGCGCGGAACGATCTGGGTCATCCTGCTC
TGCGGCGGCGATAAATCGTCGCAACAGGCCGACATCCGCGCCGCGCACGCGATGCTCGCGCATCTCGACATGGAGTAA

Antitoxin


Download         Length: 62 bp

>AT193315 NZ_CP070148:1891400-1891461 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References