Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 5091813..5092034 | Replicon | chromosome |
| Accession | NZ_CP070134 | ||
| Organism | Escherichia coli strain FDAARGOS_1281 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A229AEQ8 |
| Locus tag | I6K11_RS25465 | Protein ID | WP_000176713.1 |
| Coordinates | 5091813..5091920 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 5091968..5092034 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I6K11_RS25435 (5086947) | 5086947..5088029 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| I6K11_RS25440 (5088029) | 5088029..5088862 | + | 834 | WP_000456570.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| I6K11_RS25445 (5088859) | 5088859..5089251 | + | 393 | WP_000200377.1 | invasion regulator SirB2 | - |
| I6K11_RS25450 (5089255) | 5089255..5090064 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| I6K11_RS25455 (5090100) | 5090100..5090954 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| I6K11_RS25460 (5091149) | 5091149..5091607 | + | 459 | WP_000526135.1 | IS200/IS605-like element IS200C family transposase | - |
| I6K11_RS25465 (5091813) | 5091813..5091920 | - | 108 | WP_000176713.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (5091970) | 5091970..5092033 | + | 64 | NuclAT_46 | - | - |
| - (5091970) | 5091970..5092033 | + | 64 | NuclAT_46 | - | - |
| - (5091970) | 5091970..5092033 | + | 64 | NuclAT_46 | - | - |
| - (5091970) | 5091970..5092033 | + | 64 | NuclAT_46 | - | - |
| - (5091970) | 5091970..5092033 | + | 64 | NuclAT_48 | - | - |
| - (5091970) | 5091970..5092033 | + | 64 | NuclAT_48 | - | - |
| - (5091970) | 5091970..5092033 | + | 64 | NuclAT_48 | - | - |
| - (5091970) | 5091970..5092033 | + | 64 | NuclAT_48 | - | - |
| - (5091968) | 5091968..5092034 | + | 67 | NuclAT_21 | - | Antitoxin |
| - (5091968) | 5091968..5092034 | + | 67 | NuclAT_21 | - | Antitoxin |
| - (5091968) | 5091968..5092034 | + | 67 | NuclAT_21 | - | Antitoxin |
| - (5091968) | 5091968..5092034 | + | 67 | NuclAT_21 | - | Antitoxin |
| - (5091968) | 5091968..5092034 | + | 67 | NuclAT_26 | - | Antitoxin |
| - (5091968) | 5091968..5092034 | + | 67 | NuclAT_26 | - | Antitoxin |
| - (5091968) | 5091968..5092034 | + | 67 | NuclAT_26 | - | Antitoxin |
| - (5091968) | 5091968..5092034 | + | 67 | NuclAT_26 | - | Antitoxin |
| - (5091968) | 5091968..5092034 | + | 67 | NuclAT_31 | - | Antitoxin |
| - (5091968) | 5091968..5092034 | + | 67 | NuclAT_31 | - | Antitoxin |
| - (5091968) | 5091968..5092034 | + | 67 | NuclAT_31 | - | Antitoxin |
| - (5091968) | 5091968..5092034 | + | 67 | NuclAT_31 | - | Antitoxin |
| - (5091968) | 5091968..5092034 | + | 67 | NuclAT_36 | - | Antitoxin |
| - (5091968) | 5091968..5092034 | + | 67 | NuclAT_36 | - | Antitoxin |
| - (5091968) | 5091968..5092034 | + | 67 | NuclAT_36 | - | Antitoxin |
| - (5091968) | 5091968..5092034 | + | 67 | NuclAT_36 | - | Antitoxin |
| - (5091968) | 5091968..5092034 | + | 67 | NuclAT_38 | - | Antitoxin |
| - (5091968) | 5091968..5092034 | + | 67 | NuclAT_38 | - | Antitoxin |
| - (5091968) | 5091968..5092034 | + | 67 | NuclAT_38 | - | Antitoxin |
| - (5091968) | 5091968..5092034 | + | 67 | NuclAT_38 | - | Antitoxin |
| - (5091968) | 5091968..5092034 | + | 67 | NuclAT_43 | - | Antitoxin |
| - (5091968) | 5091968..5092034 | + | 67 | NuclAT_43 | - | Antitoxin |
| - (5091968) | 5091968..5092034 | + | 67 | NuclAT_43 | - | Antitoxin |
| - (5091968) | 5091968..5092034 | + | 67 | NuclAT_43 | - | Antitoxin |
| I6K11_RS25470 (5092348) | 5092348..5092455 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (5092508) | 5092508..5092569 | + | 62 | NuclAT_45 | - | - |
| - (5092508) | 5092508..5092569 | + | 62 | NuclAT_45 | - | - |
| - (5092508) | 5092508..5092569 | + | 62 | NuclAT_45 | - | - |
| - (5092508) | 5092508..5092569 | + | 62 | NuclAT_45 | - | - |
| - (5092508) | 5092508..5092569 | + | 62 | NuclAT_47 | - | - |
| - (5092508) | 5092508..5092569 | + | 62 | NuclAT_47 | - | - |
| - (5092508) | 5092508..5092569 | + | 62 | NuclAT_47 | - | - |
| - (5092508) | 5092508..5092569 | + | 62 | NuclAT_47 | - | - |
| - (5092508) | 5092508..5092570 | + | 63 | NuclAT_22 | - | - |
| - (5092508) | 5092508..5092570 | + | 63 | NuclAT_22 | - | - |
| - (5092508) | 5092508..5092570 | + | 63 | NuclAT_22 | - | - |
| - (5092508) | 5092508..5092570 | + | 63 | NuclAT_22 | - | - |
| - (5092508) | 5092508..5092570 | + | 63 | NuclAT_27 | - | - |
| - (5092508) | 5092508..5092570 | + | 63 | NuclAT_27 | - | - |
| - (5092508) | 5092508..5092570 | + | 63 | NuclAT_27 | - | - |
| - (5092508) | 5092508..5092570 | + | 63 | NuclAT_27 | - | - |
| - (5092508) | 5092508..5092570 | + | 63 | NuclAT_32 | - | - |
| - (5092508) | 5092508..5092570 | + | 63 | NuclAT_32 | - | - |
| - (5092508) | 5092508..5092570 | + | 63 | NuclAT_32 | - | - |
| - (5092508) | 5092508..5092570 | + | 63 | NuclAT_32 | - | - |
| - (5092508) | 5092508..5092570 | + | 63 | NuclAT_37 | - | - |
| - (5092508) | 5092508..5092570 | + | 63 | NuclAT_37 | - | - |
| - (5092508) | 5092508..5092570 | + | 63 | NuclAT_37 | - | - |
| - (5092508) | 5092508..5092570 | + | 63 | NuclAT_37 | - | - |
| - (5092508) | 5092508..5092570 | + | 63 | NuclAT_39 | - | - |
| - (5092508) | 5092508..5092570 | + | 63 | NuclAT_39 | - | - |
| - (5092508) | 5092508..5092570 | + | 63 | NuclAT_39 | - | - |
| - (5092508) | 5092508..5092570 | + | 63 | NuclAT_39 | - | - |
| - (5092508) | 5092508..5092570 | + | 63 | NuclAT_44 | - | - |
| - (5092508) | 5092508..5092570 | + | 63 | NuclAT_44 | - | - |
| - (5092508) | 5092508..5092570 | + | 63 | NuclAT_44 | - | - |
| - (5092508) | 5092508..5092570 | + | 63 | NuclAT_44 | - | - |
| I6K11_RS25475 (5092861) | 5092861..5093961 | - | 1101 | WP_001309461.1 | sodium-potassium/proton antiporter ChaA | - |
| I6K11_RS25480 (5094231) | 5094231..5094461 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| I6K11_RS25485 (5094619) | 5094619..5095314 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| I6K11_RS25490 (5095358) | 5095358..5095711 | - | 354 | WP_001169659.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 5091149..5091607 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4031.79 Da Isoelectric Point: 11.4779
>T193291 WP_000176713.1 NZ_CP070134:c5091920-5091813 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T193291 NZ_CP092843:189728-190129 [Burkholderia ambifaria]
ATGCCGCGCTATATGCTCGACACCAACATGTGCATCTATCTGATGAAGAATCAGCCGGAGCAGGTCGCGACGCGGTTCGC
GCAGTGTTACACCGGAGACGTCGTGATGTCGGCGATTACCTATGCCGAACTCGAGTACGGCGTTACCGTGTGCGCGAATC
CTGCCCGCGAGCGTCGCCATCTTGCCGCGCTGATTGACGATATTCCGGTTGCGCCGTTCGACGTCGCGGCTGCGCAAGCG
TATGGTCCGGTCCGCGAGGCAACCCGCGAGCGAAAGAAGGATCACCTCGACAAATTGATCGCCGCTCATGCGGTGTCGCT
CGATGTCGTCCTCGTGACCAACAACGAGCGGGATTTCGTCAGCTACCCGGGGTTGCGGTTGGAGAACTGGCTGAACGATT
AG
ATGCCGCGCTATATGCTCGACACCAACATGTGCATCTATCTGATGAAGAATCAGCCGGAGCAGGTCGCGACGCGGTTCGC
GCAGTGTTACACCGGAGACGTCGTGATGTCGGCGATTACCTATGCCGAACTCGAGTACGGCGTTACCGTGTGCGCGAATC
CTGCCCGCGAGCGTCGCCATCTTGCCGCGCTGATTGACGATATTCCGGTTGCGCCGTTCGACGTCGCGGCTGCGCAAGCG
TATGGTCCGGTCCGCGAGGCAACCCGCGAGCGAAAGAAGGATCACCTCGACAAATTGATCGCCGCTCATGCGGTGTCGCT
CGATGTCGTCCTCGTGACCAACAACGAGCGGGATTTCGTCAGCTACCCGGGGTTGCGGTTGGAGAACTGGCTGAACGATT
AG
Antitoxin
Download Length: 67 bp
>AT193291 NZ_CP070134:5091968-5092034 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|