Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 5091813..5092034 Replicon chromosome
Accession NZ_CP070134
Organism Escherichia coli strain FDAARGOS_1281

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag I6K11_RS25465 Protein ID WP_000176713.1
Coordinates 5091813..5091920 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 5091968..5092034 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I6K11_RS25435 (5086947) 5086947..5088029 + 1083 WP_000804726.1 peptide chain release factor 1 -
I6K11_RS25440 (5088029) 5088029..5088862 + 834 WP_000456570.1 peptide chain release factor N(5)-glutamine methyltransferase -
I6K11_RS25445 (5088859) 5088859..5089251 + 393 WP_000200377.1 invasion regulator SirB2 -
I6K11_RS25450 (5089255) 5089255..5090064 + 810 WP_001257044.1 invasion regulator SirB1 -
I6K11_RS25455 (5090100) 5090100..5090954 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
I6K11_RS25460 (5091149) 5091149..5091607 + 459 WP_000526135.1 IS200/IS605-like element IS200C family transposase -
I6K11_RS25465 (5091813) 5091813..5091920 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (5091970) 5091970..5092033 + 64 NuclAT_46 - -
- (5091970) 5091970..5092033 + 64 NuclAT_46 - -
- (5091970) 5091970..5092033 + 64 NuclAT_46 - -
- (5091970) 5091970..5092033 + 64 NuclAT_46 - -
- (5091970) 5091970..5092033 + 64 NuclAT_48 - -
- (5091970) 5091970..5092033 + 64 NuclAT_48 - -
- (5091970) 5091970..5092033 + 64 NuclAT_48 - -
- (5091970) 5091970..5092033 + 64 NuclAT_48 - -
- (5091968) 5091968..5092034 + 67 NuclAT_21 - Antitoxin
- (5091968) 5091968..5092034 + 67 NuclAT_21 - Antitoxin
- (5091968) 5091968..5092034 + 67 NuclAT_21 - Antitoxin
- (5091968) 5091968..5092034 + 67 NuclAT_21 - Antitoxin
- (5091968) 5091968..5092034 + 67 NuclAT_26 - Antitoxin
- (5091968) 5091968..5092034 + 67 NuclAT_26 - Antitoxin
- (5091968) 5091968..5092034 + 67 NuclAT_26 - Antitoxin
- (5091968) 5091968..5092034 + 67 NuclAT_26 - Antitoxin
- (5091968) 5091968..5092034 + 67 NuclAT_31 - Antitoxin
- (5091968) 5091968..5092034 + 67 NuclAT_31 - Antitoxin
- (5091968) 5091968..5092034 + 67 NuclAT_31 - Antitoxin
- (5091968) 5091968..5092034 + 67 NuclAT_31 - Antitoxin
- (5091968) 5091968..5092034 + 67 NuclAT_36 - Antitoxin
- (5091968) 5091968..5092034 + 67 NuclAT_36 - Antitoxin
- (5091968) 5091968..5092034 + 67 NuclAT_36 - Antitoxin
- (5091968) 5091968..5092034 + 67 NuclAT_36 - Antitoxin
- (5091968) 5091968..5092034 + 67 NuclAT_38 - Antitoxin
- (5091968) 5091968..5092034 + 67 NuclAT_38 - Antitoxin
- (5091968) 5091968..5092034 + 67 NuclAT_38 - Antitoxin
- (5091968) 5091968..5092034 + 67 NuclAT_38 - Antitoxin
- (5091968) 5091968..5092034 + 67 NuclAT_43 - Antitoxin
- (5091968) 5091968..5092034 + 67 NuclAT_43 - Antitoxin
- (5091968) 5091968..5092034 + 67 NuclAT_43 - Antitoxin
- (5091968) 5091968..5092034 + 67 NuclAT_43 - Antitoxin
I6K11_RS25470 (5092348) 5092348..5092455 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (5092508) 5092508..5092569 + 62 NuclAT_45 - -
- (5092508) 5092508..5092569 + 62 NuclAT_45 - -
- (5092508) 5092508..5092569 + 62 NuclAT_45 - -
- (5092508) 5092508..5092569 + 62 NuclAT_45 - -
- (5092508) 5092508..5092569 + 62 NuclAT_47 - -
- (5092508) 5092508..5092569 + 62 NuclAT_47 - -
- (5092508) 5092508..5092569 + 62 NuclAT_47 - -
- (5092508) 5092508..5092569 + 62 NuclAT_47 - -
- (5092508) 5092508..5092570 + 63 NuclAT_22 - -
- (5092508) 5092508..5092570 + 63 NuclAT_22 - -
- (5092508) 5092508..5092570 + 63 NuclAT_22 - -
- (5092508) 5092508..5092570 + 63 NuclAT_22 - -
- (5092508) 5092508..5092570 + 63 NuclAT_27 - -
- (5092508) 5092508..5092570 + 63 NuclAT_27 - -
- (5092508) 5092508..5092570 + 63 NuclAT_27 - -
- (5092508) 5092508..5092570 + 63 NuclAT_27 - -
- (5092508) 5092508..5092570 + 63 NuclAT_32 - -
- (5092508) 5092508..5092570 + 63 NuclAT_32 - -
- (5092508) 5092508..5092570 + 63 NuclAT_32 - -
- (5092508) 5092508..5092570 + 63 NuclAT_32 - -
- (5092508) 5092508..5092570 + 63 NuclAT_37 - -
- (5092508) 5092508..5092570 + 63 NuclAT_37 - -
- (5092508) 5092508..5092570 + 63 NuclAT_37 - -
- (5092508) 5092508..5092570 + 63 NuclAT_37 - -
- (5092508) 5092508..5092570 + 63 NuclAT_39 - -
- (5092508) 5092508..5092570 + 63 NuclAT_39 - -
- (5092508) 5092508..5092570 + 63 NuclAT_39 - -
- (5092508) 5092508..5092570 + 63 NuclAT_39 - -
- (5092508) 5092508..5092570 + 63 NuclAT_44 - -
- (5092508) 5092508..5092570 + 63 NuclAT_44 - -
- (5092508) 5092508..5092570 + 63 NuclAT_44 - -
- (5092508) 5092508..5092570 + 63 NuclAT_44 - -
I6K11_RS25475 (5092861) 5092861..5093961 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
I6K11_RS25480 (5094231) 5094231..5094461 + 231 WP_001146444.1 putative cation transport regulator ChaB -
I6K11_RS25485 (5094619) 5094619..5095314 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
I6K11_RS25490 (5095358) 5095358..5095711 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 5091149..5091607 458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T193291 WP_000176713.1 NZ_CP070134:c5091920-5091813 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T193291 NZ_CP092843:189728-190129 [Burkholderia ambifaria]
ATGCCGCGCTATATGCTCGACACCAACATGTGCATCTATCTGATGAAGAATCAGCCGGAGCAGGTCGCGACGCGGTTCGC
GCAGTGTTACACCGGAGACGTCGTGATGTCGGCGATTACCTATGCCGAACTCGAGTACGGCGTTACCGTGTGCGCGAATC
CTGCCCGCGAGCGTCGCCATCTTGCCGCGCTGATTGACGATATTCCGGTTGCGCCGTTCGACGTCGCGGCTGCGCAAGCG
TATGGTCCGGTCCGCGAGGCAACCCGCGAGCGAAAGAAGGATCACCTCGACAAATTGATCGCCGCTCATGCGGTGTCGCT
CGATGTCGTCCTCGTGACCAACAACGAGCGGGATTTCGTCAGCTACCCGGGGTTGCGGTTGGAGAACTGGCTGAACGATT
AG

Antitoxin


Download         Length: 67 bp

>AT193291 NZ_CP070134:5091968-5092034 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8

Antitoxin

Download structure file

References