Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 50931..51200 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP070133 | ||
| Organism | Escherichia coli strain FDAARGOS_1281 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | I6K11_RS00420 | Protein ID | WP_001372321.1 |
| Coordinates | 51075..51200 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 50931..50996 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I6K11_RS27520 | 46006..46254 | + | 249 | WP_071606928.1 | hypothetical protein | - |
| I6K11_RS00390 | 46724..47251 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
| I6K11_RS00395 | 47307..47540 | + | 234 | WP_000006018.1 | DUF905 domain-containing protein | - |
| I6K11_RS00400 | 47599..49557 | + | 1959 | WP_032152921.1 | ParB/RepB/Spo0J family partition protein | - |
| I6K11_RS00405 | 49612..50046 | + | 435 | WP_000845901.1 | conjugation system SOS inhibitor PsiB | - |
| I6K11_RS00410 | 50043..50805 | + | 763 | Protein_62 | plasmid SOS inhibition protein A | - |
| I6K11_RS00415 | 50774..50962 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 50774..50998 | + | 225 | NuclAT_0 | - | - |
| - | 50774..50998 | + | 225 | NuclAT_0 | - | - |
| - | 50774..50998 | + | 225 | NuclAT_0 | - | - |
| - | 50774..50998 | + | 225 | NuclAT_0 | - | - |
| - | 50931..50996 | - | 66 | - | - | Antitoxin |
| I6K11_RS27525 | 50984..51133 | + | 150 | Protein_64 | plasmid maintenance protein Mok | - |
| I6K11_RS00420 | 51075..51200 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| I6K11_RS27530 | 51420..51650 | + | 231 | WP_071587244.1 | hypothetical protein | - |
| I6K11_RS27535 | 51648..51821 | - | 174 | Protein_67 | hypothetical protein | - |
| I6K11_RS00425 | 52119..52406 | + | 288 | WP_000107537.1 | hypothetical protein | - |
| I6K11_RS00430 | 52526..53347 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| I6K11_RS00435 | 53644..54246 | - | 603 | WP_000243709.1 | transglycosylase SLT domain-containing protein | - |
| I6K11_RS00440 | 54567..54950 | + | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| I6K11_RS00445 | 55137..55826 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul1 / qacE / aadA5 / dfrA17 / blaCTX-M-15 / aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr / mph(A) / tet(B) | - | 1..151845 | 151845 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T193252 WP_001372321.1 NZ_CP070133:51075-51200 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T193252 NZ_CP092797:69-365 [Klebsiella pneumoniae]
ATGATTGAAATCAGGCAAACAGAAGAAGTTAAAAAATGGCTTAAAGGATTAAAAGATAAAATAGCCAAAGCAAAAATTTT
AACACGGATTGAGCGGATGAAAGAGGGGAATTATGGAGATGTTGAGCCGATAGGTGATGGATATTCAGAGTTAAGAATCC
ATCAGGGTAAGGGTTACAGAGTTTATTTTGCCAACCGAAACAATGAAATTATTTTATTGCTTTGTGGCGGTGATAAAACA
ACACAACAAGCAGACATAAAAAAAGCAAAACAGATAGCGAAAAAATGGGGGTTCTGA
ATGATTGAAATCAGGCAAACAGAAGAAGTTAAAAAATGGCTTAAAGGATTAAAAGATAAAATAGCCAAAGCAAAAATTTT
AACACGGATTGAGCGGATGAAAGAGGGGAATTATGGAGATGTTGAGCCGATAGGTGATGGATATTCAGAGTTAAGAATCC
ATCAGGGTAAGGGTTACAGAGTTTATTTTGCCAACCGAAACAATGAAATTATTTTATTGCTTTGTGGCGGTGATAAAACA
ACACAACAAGCAGACATAAAAAAAGCAAAACAGATAGCGAAAAAATGGGGGTTCTGA
Antitoxin
Download Length: 66 bp
>AT193252 NZ_CP070133:c50996-50931 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|