Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
| Location | 3441182..3441403 | Replicon | chromosome |
| Accession | NZ_CP070103 | ||
| Organism | Escherichia coli strain FDAARGOS_1277 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | E3PKK3 |
| Locus tag | I6K07_RS16360 | Protein ID | WP_000170951.1 |
| Coordinates | 3441182..3441289 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 3441337..3441403 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I6K07_RS16335 (3437028) | 3437028..3438110 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| I6K07_RS16340 (3438110) | 3438110..3438943 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| I6K07_RS16345 (3438940) | 3438940..3439332 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| I6K07_RS16350 (3439336) | 3439336..3440145 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| I6K07_RS16355 (3440181) | 3440181..3441035 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| I6K07_RS16360 (3441182) | 3441182..3441289 | - | 108 | WP_000170951.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (3441339) | 3441339..3441402 | + | 64 | NuclAT_36 | - | - |
| - (3441339) | 3441339..3441402 | + | 64 | NuclAT_36 | - | - |
| - (3441339) | 3441339..3441402 | + | 64 | NuclAT_36 | - | - |
| - (3441339) | 3441339..3441402 | + | 64 | NuclAT_36 | - | - |
| - (3441339) | 3441339..3441402 | + | 64 | NuclAT_39 | - | - |
| - (3441339) | 3441339..3441402 | + | 64 | NuclAT_39 | - | - |
| - (3441339) | 3441339..3441402 | + | 64 | NuclAT_39 | - | - |
| - (3441339) | 3441339..3441402 | + | 64 | NuclAT_39 | - | - |
| - (3441339) | 3441339..3441402 | + | 64 | NuclAT_42 | - | - |
| - (3441339) | 3441339..3441402 | + | 64 | NuclAT_42 | - | - |
| - (3441339) | 3441339..3441402 | + | 64 | NuclAT_42 | - | - |
| - (3441339) | 3441339..3441402 | + | 64 | NuclAT_42 | - | - |
| - (3441339) | 3441339..3441402 | + | 64 | NuclAT_45 | - | - |
| - (3441339) | 3441339..3441402 | + | 64 | NuclAT_45 | - | - |
| - (3441339) | 3441339..3441402 | + | 64 | NuclAT_45 | - | - |
| - (3441339) | 3441339..3441402 | + | 64 | NuclAT_45 | - | - |
| - (3441339) | 3441339..3441402 | + | 64 | NuclAT_52 | - | - |
| - (3441339) | 3441339..3441402 | + | 64 | NuclAT_52 | - | - |
| - (3441339) | 3441339..3441402 | + | 64 | NuclAT_52 | - | - |
| - (3441339) | 3441339..3441402 | + | 64 | NuclAT_52 | - | - |
| - (3441339) | 3441339..3441402 | + | 64 | NuclAT_55 | - | - |
| - (3441339) | 3441339..3441402 | + | 64 | NuclAT_55 | - | - |
| - (3441339) | 3441339..3441402 | + | 64 | NuclAT_55 | - | - |
| - (3441339) | 3441339..3441402 | + | 64 | NuclAT_55 | - | - |
| - (3441337) | 3441337..3441403 | + | 67 | NuclAT_13 | - | Antitoxin |
| - (3441337) | 3441337..3441403 | + | 67 | NuclAT_13 | - | Antitoxin |
| - (3441337) | 3441337..3441403 | + | 67 | NuclAT_13 | - | Antitoxin |
| - (3441337) | 3441337..3441403 | + | 67 | NuclAT_13 | - | Antitoxin |
| - (3441337) | 3441337..3441403 | + | 67 | NuclAT_16 | - | Antitoxin |
| - (3441337) | 3441337..3441403 | + | 67 | NuclAT_16 | - | Antitoxin |
| - (3441337) | 3441337..3441403 | + | 67 | NuclAT_16 | - | Antitoxin |
| - (3441337) | 3441337..3441403 | + | 67 | NuclAT_16 | - | Antitoxin |
| - (3441337) | 3441337..3441403 | + | 67 | NuclAT_19 | - | Antitoxin |
| - (3441337) | 3441337..3441403 | + | 67 | NuclAT_19 | - | Antitoxin |
| - (3441337) | 3441337..3441403 | + | 67 | NuclAT_19 | - | Antitoxin |
| - (3441337) | 3441337..3441403 | + | 67 | NuclAT_19 | - | Antitoxin |
| - (3441337) | 3441337..3441403 | + | 67 | NuclAT_22 | - | Antitoxin |
| - (3441337) | 3441337..3441403 | + | 67 | NuclAT_22 | - | Antitoxin |
| - (3441337) | 3441337..3441403 | + | 67 | NuclAT_22 | - | Antitoxin |
| - (3441337) | 3441337..3441403 | + | 67 | NuclAT_22 | - | Antitoxin |
| - (3441337) | 3441337..3441403 | + | 67 | NuclAT_25 | - | Antitoxin |
| - (3441337) | 3441337..3441403 | + | 67 | NuclAT_25 | - | Antitoxin |
| - (3441337) | 3441337..3441403 | + | 67 | NuclAT_25 | - | Antitoxin |
| - (3441337) | 3441337..3441403 | + | 67 | NuclAT_25 | - | Antitoxin |
| - (3441337) | 3441337..3441403 | + | 67 | NuclAT_28 | - | Antitoxin |
| - (3441337) | 3441337..3441403 | + | 67 | NuclAT_28 | - | Antitoxin |
| - (3441337) | 3441337..3441403 | + | 67 | NuclAT_28 | - | Antitoxin |
| - (3441337) | 3441337..3441403 | + | 67 | NuclAT_28 | - | Antitoxin |
| - (3441339) | 3441339..3441404 | + | 66 | NuclAT_58 | - | - |
| - (3441339) | 3441339..3441404 | + | 66 | NuclAT_58 | - | - |
| - (3441339) | 3441339..3441404 | + | 66 | NuclAT_58 | - | - |
| - (3441339) | 3441339..3441404 | + | 66 | NuclAT_58 | - | - |
| I6K07_RS16365 (3441717) | 3441717..3441824 | - | 108 | WP_000170951.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (3441874) | 3441874..3441937 | + | 64 | NuclAT_37 | - | - |
| - (3441874) | 3441874..3441937 | + | 64 | NuclAT_37 | - | - |
| - (3441874) | 3441874..3441937 | + | 64 | NuclAT_37 | - | - |
| - (3441874) | 3441874..3441937 | + | 64 | NuclAT_37 | - | - |
| - (3441874) | 3441874..3441937 | + | 64 | NuclAT_40 | - | - |
| - (3441874) | 3441874..3441937 | + | 64 | NuclAT_40 | - | - |
| - (3441874) | 3441874..3441937 | + | 64 | NuclAT_40 | - | - |
| - (3441874) | 3441874..3441937 | + | 64 | NuclAT_40 | - | - |
| - (3441874) | 3441874..3441937 | + | 64 | NuclAT_43 | - | - |
| - (3441874) | 3441874..3441937 | + | 64 | NuclAT_43 | - | - |
| - (3441874) | 3441874..3441937 | + | 64 | NuclAT_43 | - | - |
| - (3441874) | 3441874..3441937 | + | 64 | NuclAT_43 | - | - |
| - (3441874) | 3441874..3441937 | + | 64 | NuclAT_46 | - | - |
| - (3441874) | 3441874..3441937 | + | 64 | NuclAT_46 | - | - |
| - (3441874) | 3441874..3441937 | + | 64 | NuclAT_46 | - | - |
| - (3441874) | 3441874..3441937 | + | 64 | NuclAT_46 | - | - |
| - (3441874) | 3441874..3441937 | + | 64 | NuclAT_53 | - | - |
| - (3441874) | 3441874..3441937 | + | 64 | NuclAT_53 | - | - |
| - (3441874) | 3441874..3441937 | + | 64 | NuclAT_53 | - | - |
| - (3441874) | 3441874..3441937 | + | 64 | NuclAT_53 | - | - |
| - (3441874) | 3441874..3441937 | + | 64 | NuclAT_56 | - | - |
| - (3441874) | 3441874..3441937 | + | 64 | NuclAT_56 | - | - |
| - (3441874) | 3441874..3441937 | + | 64 | NuclAT_56 | - | - |
| - (3441874) | 3441874..3441937 | + | 64 | NuclAT_56 | - | - |
| - (3441872) | 3441872..3441938 | + | 67 | NuclAT_14 | - | - |
| - (3441872) | 3441872..3441938 | + | 67 | NuclAT_14 | - | - |
| - (3441872) | 3441872..3441938 | + | 67 | NuclAT_14 | - | - |
| - (3441872) | 3441872..3441938 | + | 67 | NuclAT_14 | - | - |
| - (3441872) | 3441872..3441938 | + | 67 | NuclAT_17 | - | - |
| - (3441872) | 3441872..3441938 | + | 67 | NuclAT_17 | - | - |
| - (3441872) | 3441872..3441938 | + | 67 | NuclAT_17 | - | - |
| - (3441872) | 3441872..3441938 | + | 67 | NuclAT_17 | - | - |
| - (3441872) | 3441872..3441938 | + | 67 | NuclAT_20 | - | - |
| - (3441872) | 3441872..3441938 | + | 67 | NuclAT_20 | - | - |
| - (3441872) | 3441872..3441938 | + | 67 | NuclAT_20 | - | - |
| - (3441872) | 3441872..3441938 | + | 67 | NuclAT_20 | - | - |
| - (3441872) | 3441872..3441938 | + | 67 | NuclAT_23 | - | - |
| - (3441872) | 3441872..3441938 | + | 67 | NuclAT_23 | - | - |
| - (3441872) | 3441872..3441938 | + | 67 | NuclAT_23 | - | - |
| - (3441872) | 3441872..3441938 | + | 67 | NuclAT_23 | - | - |
| - (3441872) | 3441872..3441938 | + | 67 | NuclAT_26 | - | - |
| - (3441872) | 3441872..3441938 | + | 67 | NuclAT_26 | - | - |
| - (3441872) | 3441872..3441938 | + | 67 | NuclAT_26 | - | - |
| - (3441872) | 3441872..3441938 | + | 67 | NuclAT_26 | - | - |
| - (3441872) | 3441872..3441938 | + | 67 | NuclAT_29 | - | - |
| - (3441872) | 3441872..3441938 | + | 67 | NuclAT_29 | - | - |
| - (3441872) | 3441872..3441938 | + | 67 | NuclAT_29 | - | - |
| - (3441872) | 3441872..3441938 | + | 67 | NuclAT_29 | - | - |
| - (3441874) | 3441874..3441939 | + | 66 | NuclAT_59 | - | - |
| - (3441874) | 3441874..3441939 | + | 66 | NuclAT_59 | - | - |
| - (3441874) | 3441874..3441939 | + | 66 | NuclAT_59 | - | - |
| - (3441874) | 3441874..3441939 | + | 66 | NuclAT_59 | - | - |
| I6K07_RS16370 (3442252) | 3442252..3442359 | - | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (3442407) | 3442407..3442472 | + | 66 | NuclAT_35 | - | - |
| - (3442407) | 3442407..3442472 | + | 66 | NuclAT_35 | - | - |
| - (3442407) | 3442407..3442472 | + | 66 | NuclAT_35 | - | - |
| - (3442407) | 3442407..3442472 | + | 66 | NuclAT_35 | - | - |
| - (3442407) | 3442407..3442472 | + | 66 | NuclAT_38 | - | - |
| - (3442407) | 3442407..3442472 | + | 66 | NuclAT_38 | - | - |
| - (3442407) | 3442407..3442472 | + | 66 | NuclAT_38 | - | - |
| - (3442407) | 3442407..3442472 | + | 66 | NuclAT_38 | - | - |
| - (3442407) | 3442407..3442472 | + | 66 | NuclAT_41 | - | - |
| - (3442407) | 3442407..3442472 | + | 66 | NuclAT_41 | - | - |
| - (3442407) | 3442407..3442472 | + | 66 | NuclAT_41 | - | - |
| - (3442407) | 3442407..3442472 | + | 66 | NuclAT_41 | - | - |
| - (3442407) | 3442407..3442472 | + | 66 | NuclAT_44 | - | - |
| - (3442407) | 3442407..3442472 | + | 66 | NuclAT_44 | - | - |
| - (3442407) | 3442407..3442472 | + | 66 | NuclAT_44 | - | - |
| - (3442407) | 3442407..3442472 | + | 66 | NuclAT_44 | - | - |
| - (3442407) | 3442407..3442472 | + | 66 | NuclAT_51 | - | - |
| - (3442407) | 3442407..3442472 | + | 66 | NuclAT_51 | - | - |
| - (3442407) | 3442407..3442472 | + | 66 | NuclAT_51 | - | - |
| - (3442407) | 3442407..3442472 | + | 66 | NuclAT_51 | - | - |
| - (3442407) | 3442407..3442472 | + | 66 | NuclAT_54 | - | - |
| - (3442407) | 3442407..3442472 | + | 66 | NuclAT_54 | - | - |
| - (3442407) | 3442407..3442472 | + | 66 | NuclAT_54 | - | - |
| - (3442407) | 3442407..3442472 | + | 66 | NuclAT_54 | - | - |
| - (3442408) | 3442408..3442473 | + | 66 | NuclAT_15 | - | - |
| - (3442408) | 3442408..3442473 | + | 66 | NuclAT_15 | - | - |
| - (3442408) | 3442408..3442473 | + | 66 | NuclAT_15 | - | - |
| - (3442408) | 3442408..3442473 | + | 66 | NuclAT_15 | - | - |
| - (3442408) | 3442408..3442473 | + | 66 | NuclAT_18 | - | - |
| - (3442408) | 3442408..3442473 | + | 66 | NuclAT_18 | - | - |
| - (3442408) | 3442408..3442473 | + | 66 | NuclAT_18 | - | - |
| - (3442408) | 3442408..3442473 | + | 66 | NuclAT_18 | - | - |
| - (3442408) | 3442408..3442473 | + | 66 | NuclAT_21 | - | - |
| - (3442408) | 3442408..3442473 | + | 66 | NuclAT_21 | - | - |
| - (3442408) | 3442408..3442473 | + | 66 | NuclAT_21 | - | - |
| - (3442408) | 3442408..3442473 | + | 66 | NuclAT_21 | - | - |
| - (3442408) | 3442408..3442473 | + | 66 | NuclAT_24 | - | - |
| - (3442408) | 3442408..3442473 | + | 66 | NuclAT_24 | - | - |
| - (3442408) | 3442408..3442473 | + | 66 | NuclAT_24 | - | - |
| - (3442408) | 3442408..3442473 | + | 66 | NuclAT_24 | - | - |
| - (3442408) | 3442408..3442473 | + | 66 | NuclAT_27 | - | - |
| - (3442408) | 3442408..3442473 | + | 66 | NuclAT_27 | - | - |
| - (3442408) | 3442408..3442473 | + | 66 | NuclAT_27 | - | - |
| - (3442408) | 3442408..3442473 | + | 66 | NuclAT_27 | - | - |
| - (3442408) | 3442408..3442473 | + | 66 | NuclAT_30 | - | - |
| - (3442408) | 3442408..3442473 | + | 66 | NuclAT_30 | - | - |
| - (3442408) | 3442408..3442473 | + | 66 | NuclAT_30 | - | - |
| - (3442408) | 3442408..3442473 | + | 66 | NuclAT_30 | - | - |
| - (3442407) | 3442407..3442474 | + | 68 | NuclAT_57 | - | - |
| - (3442407) | 3442407..3442474 | + | 68 | NuclAT_57 | - | - |
| - (3442407) | 3442407..3442474 | + | 68 | NuclAT_57 | - | - |
| - (3442407) | 3442407..3442474 | + | 68 | NuclAT_57 | - | - |
| I6K07_RS16375 (3442764) | 3442764..3443864 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| I6K07_RS16380 (3444134) | 3444134..3444364 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| I6K07_RS16385 (3444522) | 3444522..3445217 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| I6K07_RS16390 (3445261) | 3445261..3445614 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3961.74 Da Isoelectric Point: 9.1413
>T193118 WP_000170951.1 NZ_CP070103:c3441289-3441182 [Escherichia coli]
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T193118 NZ_CP092712:c1384274-1383996 [Aliivibrio fischeri ATCC 7744 = JCM 18803 = DSM 507]
ATGATCTTTTGGGAAGAAGAGTCTTTAAATGATCGTGAGAAAATATTTGAATTTCTTTACGACTTTAATCCAAGTGTCGC
TGAAAGAACAGATAACACCATCGAACAGACGGTTGAGGCTTTGTTAGATCAACCTCAAATGGGTGTGCAACGTGAAAATA
TCAGAGGACGACTACTCATTATTCCTGAAGTATCAATGATTGTTTCATACATGATTGATGGAGAGAGCATTAGAATAATG
CGCGTCCTCCACCAAAAGCAAAAGTTTCCGATTGATTAG
ATGATCTTTTGGGAAGAAGAGTCTTTAAATGATCGTGAGAAAATATTTGAATTTCTTTACGACTTTAATCCAAGTGTCGC
TGAAAGAACAGATAACACCATCGAACAGACGGTTGAGGCTTTGTTAGATCAACCTCAAATGGGTGTGCAACGTGAAAATA
TCAGAGGACGACTACTCATTATTCCTGAAGTATCAATGATTGTTTCATACATGATTGATGGAGAGAGCATTAGAATAATG
CGCGTCCTCCACCAAAAGCAAAAGTTTCCGATTGATTAG
Antitoxin
Download Length: 67 bp
>AT193118 NZ_CP070103:3441337-3441403 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|