Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 3441182..3441403 Replicon chromosome
Accession NZ_CP070103
Organism Escherichia coli strain FDAARGOS_1277

Toxin (Protein)


Gene name ldrD Uniprot ID E3PKK3
Locus tag I6K07_RS16360 Protein ID WP_000170951.1
Coordinates 3441182..3441289 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 3441337..3441403 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I6K07_RS16335 (3437028) 3437028..3438110 + 1083 WP_000804726.1 peptide chain release factor 1 -
I6K07_RS16340 (3438110) 3438110..3438943 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
I6K07_RS16345 (3438940) 3438940..3439332 + 393 WP_000200374.1 invasion regulator SirB2 -
I6K07_RS16350 (3439336) 3439336..3440145 + 810 WP_001257044.1 invasion regulator SirB1 -
I6K07_RS16355 (3440181) 3440181..3441035 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
I6K07_RS16360 (3441182) 3441182..3441289 - 108 WP_000170951.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (3441339) 3441339..3441402 + 64 NuclAT_36 - -
- (3441339) 3441339..3441402 + 64 NuclAT_36 - -
- (3441339) 3441339..3441402 + 64 NuclAT_36 - -
- (3441339) 3441339..3441402 + 64 NuclAT_36 - -
- (3441339) 3441339..3441402 + 64 NuclAT_39 - -
- (3441339) 3441339..3441402 + 64 NuclAT_39 - -
- (3441339) 3441339..3441402 + 64 NuclAT_39 - -
- (3441339) 3441339..3441402 + 64 NuclAT_39 - -
- (3441339) 3441339..3441402 + 64 NuclAT_42 - -
- (3441339) 3441339..3441402 + 64 NuclAT_42 - -
- (3441339) 3441339..3441402 + 64 NuclAT_42 - -
- (3441339) 3441339..3441402 + 64 NuclAT_42 - -
- (3441339) 3441339..3441402 + 64 NuclAT_45 - -
- (3441339) 3441339..3441402 + 64 NuclAT_45 - -
- (3441339) 3441339..3441402 + 64 NuclAT_45 - -
- (3441339) 3441339..3441402 + 64 NuclAT_45 - -
- (3441339) 3441339..3441402 + 64 NuclAT_52 - -
- (3441339) 3441339..3441402 + 64 NuclAT_52 - -
- (3441339) 3441339..3441402 + 64 NuclAT_52 - -
- (3441339) 3441339..3441402 + 64 NuclAT_52 - -
- (3441339) 3441339..3441402 + 64 NuclAT_55 - -
- (3441339) 3441339..3441402 + 64 NuclAT_55 - -
- (3441339) 3441339..3441402 + 64 NuclAT_55 - -
- (3441339) 3441339..3441402 + 64 NuclAT_55 - -
- (3441337) 3441337..3441403 + 67 NuclAT_13 - Antitoxin
- (3441337) 3441337..3441403 + 67 NuclAT_13 - Antitoxin
- (3441337) 3441337..3441403 + 67 NuclAT_13 - Antitoxin
- (3441337) 3441337..3441403 + 67 NuclAT_13 - Antitoxin
- (3441337) 3441337..3441403 + 67 NuclAT_16 - Antitoxin
- (3441337) 3441337..3441403 + 67 NuclAT_16 - Antitoxin
- (3441337) 3441337..3441403 + 67 NuclAT_16 - Antitoxin
- (3441337) 3441337..3441403 + 67 NuclAT_16 - Antitoxin
- (3441337) 3441337..3441403 + 67 NuclAT_19 - Antitoxin
- (3441337) 3441337..3441403 + 67 NuclAT_19 - Antitoxin
- (3441337) 3441337..3441403 + 67 NuclAT_19 - Antitoxin
- (3441337) 3441337..3441403 + 67 NuclAT_19 - Antitoxin
- (3441337) 3441337..3441403 + 67 NuclAT_22 - Antitoxin
- (3441337) 3441337..3441403 + 67 NuclAT_22 - Antitoxin
- (3441337) 3441337..3441403 + 67 NuclAT_22 - Antitoxin
- (3441337) 3441337..3441403 + 67 NuclAT_22 - Antitoxin
- (3441337) 3441337..3441403 + 67 NuclAT_25 - Antitoxin
- (3441337) 3441337..3441403 + 67 NuclAT_25 - Antitoxin
- (3441337) 3441337..3441403 + 67 NuclAT_25 - Antitoxin
- (3441337) 3441337..3441403 + 67 NuclAT_25 - Antitoxin
- (3441337) 3441337..3441403 + 67 NuclAT_28 - Antitoxin
- (3441337) 3441337..3441403 + 67 NuclAT_28 - Antitoxin
- (3441337) 3441337..3441403 + 67 NuclAT_28 - Antitoxin
- (3441337) 3441337..3441403 + 67 NuclAT_28 - Antitoxin
- (3441339) 3441339..3441404 + 66 NuclAT_58 - -
- (3441339) 3441339..3441404 + 66 NuclAT_58 - -
- (3441339) 3441339..3441404 + 66 NuclAT_58 - -
- (3441339) 3441339..3441404 + 66 NuclAT_58 - -
I6K07_RS16365 (3441717) 3441717..3441824 - 108 WP_000170951.1 type I toxin-antitoxin system toxin Ldr family protein -
- (3441874) 3441874..3441937 + 64 NuclAT_37 - -
- (3441874) 3441874..3441937 + 64 NuclAT_37 - -
- (3441874) 3441874..3441937 + 64 NuclAT_37 - -
- (3441874) 3441874..3441937 + 64 NuclAT_37 - -
- (3441874) 3441874..3441937 + 64 NuclAT_40 - -
- (3441874) 3441874..3441937 + 64 NuclAT_40 - -
- (3441874) 3441874..3441937 + 64 NuclAT_40 - -
- (3441874) 3441874..3441937 + 64 NuclAT_40 - -
- (3441874) 3441874..3441937 + 64 NuclAT_43 - -
- (3441874) 3441874..3441937 + 64 NuclAT_43 - -
- (3441874) 3441874..3441937 + 64 NuclAT_43 - -
- (3441874) 3441874..3441937 + 64 NuclAT_43 - -
- (3441874) 3441874..3441937 + 64 NuclAT_46 - -
- (3441874) 3441874..3441937 + 64 NuclAT_46 - -
- (3441874) 3441874..3441937 + 64 NuclAT_46 - -
- (3441874) 3441874..3441937 + 64 NuclAT_46 - -
- (3441874) 3441874..3441937 + 64 NuclAT_53 - -
- (3441874) 3441874..3441937 + 64 NuclAT_53 - -
- (3441874) 3441874..3441937 + 64 NuclAT_53 - -
- (3441874) 3441874..3441937 + 64 NuclAT_53 - -
- (3441874) 3441874..3441937 + 64 NuclAT_56 - -
- (3441874) 3441874..3441937 + 64 NuclAT_56 - -
- (3441874) 3441874..3441937 + 64 NuclAT_56 - -
- (3441874) 3441874..3441937 + 64 NuclAT_56 - -
- (3441872) 3441872..3441938 + 67 NuclAT_14 - -
- (3441872) 3441872..3441938 + 67 NuclAT_14 - -
- (3441872) 3441872..3441938 + 67 NuclAT_14 - -
- (3441872) 3441872..3441938 + 67 NuclAT_14 - -
- (3441872) 3441872..3441938 + 67 NuclAT_17 - -
- (3441872) 3441872..3441938 + 67 NuclAT_17 - -
- (3441872) 3441872..3441938 + 67 NuclAT_17 - -
- (3441872) 3441872..3441938 + 67 NuclAT_17 - -
- (3441872) 3441872..3441938 + 67 NuclAT_20 - -
- (3441872) 3441872..3441938 + 67 NuclAT_20 - -
- (3441872) 3441872..3441938 + 67 NuclAT_20 - -
- (3441872) 3441872..3441938 + 67 NuclAT_20 - -
- (3441872) 3441872..3441938 + 67 NuclAT_23 - -
- (3441872) 3441872..3441938 + 67 NuclAT_23 - -
- (3441872) 3441872..3441938 + 67 NuclAT_23 - -
- (3441872) 3441872..3441938 + 67 NuclAT_23 - -
- (3441872) 3441872..3441938 + 67 NuclAT_26 - -
- (3441872) 3441872..3441938 + 67 NuclAT_26 - -
- (3441872) 3441872..3441938 + 67 NuclAT_26 - -
- (3441872) 3441872..3441938 + 67 NuclAT_26 - -
- (3441872) 3441872..3441938 + 67 NuclAT_29 - -
- (3441872) 3441872..3441938 + 67 NuclAT_29 - -
- (3441872) 3441872..3441938 + 67 NuclAT_29 - -
- (3441872) 3441872..3441938 + 67 NuclAT_29 - -
- (3441874) 3441874..3441939 + 66 NuclAT_59 - -
- (3441874) 3441874..3441939 + 66 NuclAT_59 - -
- (3441874) 3441874..3441939 + 66 NuclAT_59 - -
- (3441874) 3441874..3441939 + 66 NuclAT_59 - -
I6K07_RS16370 (3442252) 3442252..3442359 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein -
- (3442407) 3442407..3442472 + 66 NuclAT_35 - -
- (3442407) 3442407..3442472 + 66 NuclAT_35 - -
- (3442407) 3442407..3442472 + 66 NuclAT_35 - -
- (3442407) 3442407..3442472 + 66 NuclAT_35 - -
- (3442407) 3442407..3442472 + 66 NuclAT_38 - -
- (3442407) 3442407..3442472 + 66 NuclAT_38 - -
- (3442407) 3442407..3442472 + 66 NuclAT_38 - -
- (3442407) 3442407..3442472 + 66 NuclAT_38 - -
- (3442407) 3442407..3442472 + 66 NuclAT_41 - -
- (3442407) 3442407..3442472 + 66 NuclAT_41 - -
- (3442407) 3442407..3442472 + 66 NuclAT_41 - -
- (3442407) 3442407..3442472 + 66 NuclAT_41 - -
- (3442407) 3442407..3442472 + 66 NuclAT_44 - -
- (3442407) 3442407..3442472 + 66 NuclAT_44 - -
- (3442407) 3442407..3442472 + 66 NuclAT_44 - -
- (3442407) 3442407..3442472 + 66 NuclAT_44 - -
- (3442407) 3442407..3442472 + 66 NuclAT_51 - -
- (3442407) 3442407..3442472 + 66 NuclAT_51 - -
- (3442407) 3442407..3442472 + 66 NuclAT_51 - -
- (3442407) 3442407..3442472 + 66 NuclAT_51 - -
- (3442407) 3442407..3442472 + 66 NuclAT_54 - -
- (3442407) 3442407..3442472 + 66 NuclAT_54 - -
- (3442407) 3442407..3442472 + 66 NuclAT_54 - -
- (3442407) 3442407..3442472 + 66 NuclAT_54 - -
- (3442408) 3442408..3442473 + 66 NuclAT_15 - -
- (3442408) 3442408..3442473 + 66 NuclAT_15 - -
- (3442408) 3442408..3442473 + 66 NuclAT_15 - -
- (3442408) 3442408..3442473 + 66 NuclAT_15 - -
- (3442408) 3442408..3442473 + 66 NuclAT_18 - -
- (3442408) 3442408..3442473 + 66 NuclAT_18 - -
- (3442408) 3442408..3442473 + 66 NuclAT_18 - -
- (3442408) 3442408..3442473 + 66 NuclAT_18 - -
- (3442408) 3442408..3442473 + 66 NuclAT_21 - -
- (3442408) 3442408..3442473 + 66 NuclAT_21 - -
- (3442408) 3442408..3442473 + 66 NuclAT_21 - -
- (3442408) 3442408..3442473 + 66 NuclAT_21 - -
- (3442408) 3442408..3442473 + 66 NuclAT_24 - -
- (3442408) 3442408..3442473 + 66 NuclAT_24 - -
- (3442408) 3442408..3442473 + 66 NuclAT_24 - -
- (3442408) 3442408..3442473 + 66 NuclAT_24 - -
- (3442408) 3442408..3442473 + 66 NuclAT_27 - -
- (3442408) 3442408..3442473 + 66 NuclAT_27 - -
- (3442408) 3442408..3442473 + 66 NuclAT_27 - -
- (3442408) 3442408..3442473 + 66 NuclAT_27 - -
- (3442408) 3442408..3442473 + 66 NuclAT_30 - -
- (3442408) 3442408..3442473 + 66 NuclAT_30 - -
- (3442408) 3442408..3442473 + 66 NuclAT_30 - -
- (3442408) 3442408..3442473 + 66 NuclAT_30 - -
- (3442407) 3442407..3442474 + 68 NuclAT_57 - -
- (3442407) 3442407..3442474 + 68 NuclAT_57 - -
- (3442407) 3442407..3442474 + 68 NuclAT_57 - -
- (3442407) 3442407..3442474 + 68 NuclAT_57 - -
I6K07_RS16375 (3442764) 3442764..3443864 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
I6K07_RS16380 (3444134) 3444134..3444364 + 231 WP_001146444.1 putative cation transport regulator ChaB -
I6K07_RS16385 (3444522) 3444522..3445217 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
I6K07_RS16390 (3445261) 3445261..3445614 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3961.74 Da        Isoelectric Point: 9.1413

>T193118 WP_000170951.1 NZ_CP070103:c3441289-3441182 [Escherichia coli]
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T193118 NZ_CP092712:c1384274-1383996 [Aliivibrio fischeri ATCC 7744 = JCM 18803 = DSM 507]
ATGATCTTTTGGGAAGAAGAGTCTTTAAATGATCGTGAGAAAATATTTGAATTTCTTTACGACTTTAATCCAAGTGTCGC
TGAAAGAACAGATAACACCATCGAACAGACGGTTGAGGCTTTGTTAGATCAACCTCAAATGGGTGTGCAACGTGAAAATA
TCAGAGGACGACTACTCATTATTCCTGAAGTATCAATGATTGTTTCATACATGATTGATGGAGAGAGCATTAGAATAATG
CGCGTCCTCCACCAAAAGCAAAAGTTTCCGATTGATTAG

Antitoxin


Download         Length: 67 bp

>AT193118 NZ_CP070103:3441337-3441403 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB E3PKK3


Antitoxin

Download structure file

References