Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1250631..1250852 Replicon chromosome
Accession NZ_CP070098
Organism Escherichia coli strain FDAARGOS_1370

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag I6L00_RS06515 Protein ID WP_000176713.1
Coordinates 1250631..1250738 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1250786..1250852 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I6L00_RS06485 (1245765) 1245765..1246847 + 1083 WP_000804726.1 peptide chain release factor 1 -
I6L00_RS06490 (1246847) 1246847..1247680 + 834 WP_000456570.1 peptide chain release factor N(5)-glutamine methyltransferase -
I6L00_RS06495 (1247677) 1247677..1248069 + 393 WP_000200377.1 invasion regulator SirB2 -
I6L00_RS06500 (1248073) 1248073..1248882 + 810 WP_001257044.1 invasion regulator SirB1 -
I6L00_RS06505 (1248918) 1248918..1249772 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
I6L00_RS06510 (1249967) 1249967..1250425 + 459 WP_000526135.1 IS200/IS605-like element IS200C family transposase -
I6L00_RS06515 (1250631) 1250631..1250738 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1250788) 1250788..1250851 + 64 NuclAT_46 - -
- (1250788) 1250788..1250851 + 64 NuclAT_46 - -
- (1250788) 1250788..1250851 + 64 NuclAT_46 - -
- (1250788) 1250788..1250851 + 64 NuclAT_46 - -
- (1250788) 1250788..1250851 + 64 NuclAT_48 - -
- (1250788) 1250788..1250851 + 64 NuclAT_48 - -
- (1250788) 1250788..1250851 + 64 NuclAT_48 - -
- (1250788) 1250788..1250851 + 64 NuclAT_48 - -
- (1250786) 1250786..1250852 + 67 NuclAT_21 - Antitoxin
- (1250786) 1250786..1250852 + 67 NuclAT_21 - Antitoxin
- (1250786) 1250786..1250852 + 67 NuclAT_21 - Antitoxin
- (1250786) 1250786..1250852 + 67 NuclAT_21 - Antitoxin
- (1250786) 1250786..1250852 + 67 NuclAT_26 - Antitoxin
- (1250786) 1250786..1250852 + 67 NuclAT_26 - Antitoxin
- (1250786) 1250786..1250852 + 67 NuclAT_26 - Antitoxin
- (1250786) 1250786..1250852 + 67 NuclAT_26 - Antitoxin
- (1250786) 1250786..1250852 + 67 NuclAT_31 - Antitoxin
- (1250786) 1250786..1250852 + 67 NuclAT_31 - Antitoxin
- (1250786) 1250786..1250852 + 67 NuclAT_31 - Antitoxin
- (1250786) 1250786..1250852 + 67 NuclAT_31 - Antitoxin
- (1250786) 1250786..1250852 + 67 NuclAT_36 - Antitoxin
- (1250786) 1250786..1250852 + 67 NuclAT_36 - Antitoxin
- (1250786) 1250786..1250852 + 67 NuclAT_36 - Antitoxin
- (1250786) 1250786..1250852 + 67 NuclAT_36 - Antitoxin
- (1250786) 1250786..1250852 + 67 NuclAT_38 - Antitoxin
- (1250786) 1250786..1250852 + 67 NuclAT_38 - Antitoxin
- (1250786) 1250786..1250852 + 67 NuclAT_38 - Antitoxin
- (1250786) 1250786..1250852 + 67 NuclAT_38 - Antitoxin
- (1250786) 1250786..1250852 + 67 NuclAT_43 - Antitoxin
- (1250786) 1250786..1250852 + 67 NuclAT_43 - Antitoxin
- (1250786) 1250786..1250852 + 67 NuclAT_43 - Antitoxin
- (1250786) 1250786..1250852 + 67 NuclAT_43 - Antitoxin
I6L00_RS06520 (1251166) 1251166..1251273 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1251326) 1251326..1251387 + 62 NuclAT_45 - -
- (1251326) 1251326..1251387 + 62 NuclAT_45 - -
- (1251326) 1251326..1251387 + 62 NuclAT_45 - -
- (1251326) 1251326..1251387 + 62 NuclAT_45 - -
- (1251326) 1251326..1251387 + 62 NuclAT_47 - -
- (1251326) 1251326..1251387 + 62 NuclAT_47 - -
- (1251326) 1251326..1251387 + 62 NuclAT_47 - -
- (1251326) 1251326..1251387 + 62 NuclAT_47 - -
- (1251326) 1251326..1251388 + 63 NuclAT_22 - -
- (1251326) 1251326..1251388 + 63 NuclAT_22 - -
- (1251326) 1251326..1251388 + 63 NuclAT_22 - -
- (1251326) 1251326..1251388 + 63 NuclAT_22 - -
- (1251326) 1251326..1251388 + 63 NuclAT_27 - -
- (1251326) 1251326..1251388 + 63 NuclAT_27 - -
- (1251326) 1251326..1251388 + 63 NuclAT_27 - -
- (1251326) 1251326..1251388 + 63 NuclAT_27 - -
- (1251326) 1251326..1251388 + 63 NuclAT_32 - -
- (1251326) 1251326..1251388 + 63 NuclAT_32 - -
- (1251326) 1251326..1251388 + 63 NuclAT_32 - -
- (1251326) 1251326..1251388 + 63 NuclAT_32 - -
- (1251326) 1251326..1251388 + 63 NuclAT_37 - -
- (1251326) 1251326..1251388 + 63 NuclAT_37 - -
- (1251326) 1251326..1251388 + 63 NuclAT_37 - -
- (1251326) 1251326..1251388 + 63 NuclAT_37 - -
- (1251326) 1251326..1251388 + 63 NuclAT_39 - -
- (1251326) 1251326..1251388 + 63 NuclAT_39 - -
- (1251326) 1251326..1251388 + 63 NuclAT_39 - -
- (1251326) 1251326..1251388 + 63 NuclAT_39 - -
- (1251326) 1251326..1251388 + 63 NuclAT_44 - -
- (1251326) 1251326..1251388 + 63 NuclAT_44 - -
- (1251326) 1251326..1251388 + 63 NuclAT_44 - -
- (1251326) 1251326..1251388 + 63 NuclAT_44 - -
I6L00_RS06525 (1251679) 1251679..1252779 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
I6L00_RS06530 (1253049) 1253049..1253279 + 231 WP_001146444.1 putative cation transport regulator ChaB -
I6L00_RS06535 (1253437) 1253437..1254132 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
I6L00_RS06540 (1254176) 1254176..1254529 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1249967..1250425 458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T193074 WP_000176713.1 NZ_CP070098:c1250738-1250631 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T193074 NZ_CP092686:65232-65528 [Vibrio campbellii]
ATGACTTATAAGCTCAAGTTTGACAGAAAAGCTAAAAAGGCTTTTGACAAACTAGGCGAACCGGTTAAATCACAATTCAA
GGCCAAGCTGAGGGAAGTATTAACTAATCCCCACATAGTGGGCTCAGCCCTAAGAGGAAGGCTATCGGGTTGTTACAAAT
TAAAGCTAAAAAGTTCAGGATATAGACTTGTGTATAAGGTTGAAGATGGAGAATTAACGATCTTAGTACTTGCTATTGGA
AAGCGTGAAAGAAATGAAGCCTATTTAAAGGCTGAACAATCAATAGCAAGAAACTAG

Antitoxin


Download         Length: 67 bp

>AT193074 NZ_CP070098:1250786-1250852 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8

Antitoxin

Download structure file

References