Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-sokA/Ldr(toxin)
Location 2507711..2507935 Replicon chromosome
Accession NZ_CP070063
Organism Escherichia coli strain FDAARGOS_1372

Toxin (Protein)


Gene name ldrD Uniprot ID A0A366YNB7
Locus tag I6L02_RS11950 Protein ID WP_001441942.1
Coordinates 2507711..2507818 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name sokA
Locus tag -
Coordinates 2507874..2507935 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I6L02_RS11925 (2503555) 2503555..2504637 + 1083 WP_000804726.1 peptide chain release factor 1 -
I6L02_RS11930 (2504637) 2504637..2505470 + 834 WP_000456476.1 peptide chain release factor N(5)-glutamine methyltransferase -
I6L02_RS11935 (2505467) 2505467..2505859 + 393 WP_000200375.1 invasion regulator SirB2 -
I6L02_RS11940 (2505863) 2505863..2506672 + 810 WP_001257054.1 invasion regulator SirB1 -
I6L02_RS11945 (2506708) 2506708..2507562 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
I6L02_RS11950 (2507711) 2507711..2507818 - 108 WP_001441942.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2507874) 2507874..2507935 + 62 NuclAT_12 - Antitoxin
- (2507874) 2507874..2507935 + 62 NuclAT_12 - Antitoxin
- (2507874) 2507874..2507935 + 62 NuclAT_12 - Antitoxin
- (2507874) 2507874..2507935 + 62 NuclAT_12 - Antitoxin
- (2507874) 2507874..2507935 + 62 NuclAT_13 - Antitoxin
- (2507874) 2507874..2507935 + 62 NuclAT_13 - Antitoxin
- (2507874) 2507874..2507935 + 62 NuclAT_13 - Antitoxin
- (2507874) 2507874..2507935 + 62 NuclAT_13 - Antitoxin
- (2507874) 2507874..2507935 + 62 NuclAT_14 - Antitoxin
- (2507874) 2507874..2507935 + 62 NuclAT_14 - Antitoxin
- (2507874) 2507874..2507935 + 62 NuclAT_14 - Antitoxin
- (2507874) 2507874..2507935 + 62 NuclAT_14 - Antitoxin
- (2507874) 2507874..2507935 + 62 NuclAT_15 - Antitoxin
- (2507874) 2507874..2507935 + 62 NuclAT_15 - Antitoxin
- (2507874) 2507874..2507935 + 62 NuclAT_15 - Antitoxin
- (2507874) 2507874..2507935 + 62 NuclAT_15 - Antitoxin
- (2507874) 2507874..2507935 + 62 NuclAT_16 - Antitoxin
- (2507874) 2507874..2507935 + 62 NuclAT_16 - Antitoxin
- (2507874) 2507874..2507935 + 62 NuclAT_16 - Antitoxin
- (2507874) 2507874..2507935 + 62 NuclAT_16 - Antitoxin
- (2507874) 2507874..2507935 + 62 NuclAT_17 - Antitoxin
- (2507874) 2507874..2507935 + 62 NuclAT_17 - Antitoxin
- (2507874) 2507874..2507935 + 62 NuclAT_17 - Antitoxin
- (2507874) 2507874..2507935 + 62 NuclAT_17 - Antitoxin
- (2507874) 2507874..2507936 + 63 NuclAT_10 - -
- (2507874) 2507874..2507936 + 63 NuclAT_10 - -
- (2507874) 2507874..2507936 + 63 NuclAT_10 - -
- (2507874) 2507874..2507936 + 63 NuclAT_10 - -
- (2507874) 2507874..2507936 + 63 NuclAT_5 - -
- (2507874) 2507874..2507936 + 63 NuclAT_5 - -
- (2507874) 2507874..2507936 + 63 NuclAT_5 - -
- (2507874) 2507874..2507936 + 63 NuclAT_5 - -
- (2507874) 2507874..2507936 + 63 NuclAT_6 - -
- (2507874) 2507874..2507936 + 63 NuclAT_6 - -
- (2507874) 2507874..2507936 + 63 NuclAT_6 - -
- (2507874) 2507874..2507936 + 63 NuclAT_6 - -
- (2507874) 2507874..2507936 + 63 NuclAT_7 - -
- (2507874) 2507874..2507936 + 63 NuclAT_7 - -
- (2507874) 2507874..2507936 + 63 NuclAT_7 - -
- (2507874) 2507874..2507936 + 63 NuclAT_7 - -
- (2507874) 2507874..2507936 + 63 NuclAT_8 - -
- (2507874) 2507874..2507936 + 63 NuclAT_8 - -
- (2507874) 2507874..2507936 + 63 NuclAT_8 - -
- (2507874) 2507874..2507936 + 63 NuclAT_8 - -
- (2507874) 2507874..2507936 + 63 NuclAT_9 - -
- (2507874) 2507874..2507936 + 63 NuclAT_9 - -
- (2507874) 2507874..2507936 + 63 NuclAT_9 - -
- (2507874) 2507874..2507936 + 63 NuclAT_9 - -
I6L02_RS11955 (2508228) 2508228..2509328 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
I6L02_RS11960 (2509598) 2509598..2509828 + 231 WP_001146435.1 putative cation transport regulator ChaB -
I6L02_RS11965 (2509986) 2509986..2510681 + 696 WP_024176023.1 glutathione-specific gamma-glutamylcyclotransferase -
I6L02_RS11970 (2510725) 2510725..2511078 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
I6L02_RS11975 (2511263) 2511263..2512657 + 1395 WP_000085918.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3951.74 Da        Isoelectric Point: 11.4779

>T192878 WP_001441942.1 NZ_CP070063:c2507818-2507711 [Escherichia coli]
MTLAQFAVIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T192878 NZ_CP092574:c2851745-2851644 [Enterococcus faecalis]
TTGTCAATCGAAGCGACATTGGAATTGATGATTAGTTTTGCAACCCTTGTTGCGTTACTGATTTTCGGTATCCTTGAAGC
AACGAAAAACGATAAAAAATAA

Antitoxin


Download         Length: 62 bp

>AT192878 NZ_CP070063:2507874-2507935 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTGACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A366YNB7

Antitoxin

Download structure file

References