Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 795570..795791 Replicon chromosome
Accession NZ_CP070048
Organism Escherichia coli strain FDAARGOS_1290

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag I6K20_RS04065 Protein ID WP_000170965.1
Coordinates 795570..795677 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 795725..795791 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I6K20_RS04040 (791415) 791415..792497 + 1083 WP_000804726.1 peptide chain release factor 1 -
I6K20_RS04045 (792497) 792497..793330 + 834 WP_000456458.1 peptide chain release factor N(5)-glutamine methyltransferase -
I6K20_RS04050 (793327) 793327..793719 + 393 WP_000151883.1 invasion regulator SirB2 -
I6K20_RS04055 (793723) 793723..794532 + 810 WP_001257044.1 invasion regulator SirB1 -
I6K20_RS04060 (794568) 794568..795422 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
I6K20_RS04065 (795570) 795570..795677 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (795727) 795727..795790 + 64 NuclAT_29 - -
- (795727) 795727..795790 + 64 NuclAT_29 - -
- (795727) 795727..795790 + 64 NuclAT_29 - -
- (795727) 795727..795790 + 64 NuclAT_29 - -
- (795727) 795727..795790 + 64 NuclAT_31 - -
- (795727) 795727..795790 + 64 NuclAT_31 - -
- (795727) 795727..795790 + 64 NuclAT_31 - -
- (795727) 795727..795790 + 64 NuclAT_31 - -
- (795727) 795727..795790 + 64 NuclAT_33 - -
- (795727) 795727..795790 + 64 NuclAT_33 - -
- (795727) 795727..795790 + 64 NuclAT_33 - -
- (795727) 795727..795790 + 64 NuclAT_33 - -
- (795727) 795727..795790 + 64 NuclAT_35 - -
- (795727) 795727..795790 + 64 NuclAT_35 - -
- (795727) 795727..795790 + 64 NuclAT_35 - -
- (795727) 795727..795790 + 64 NuclAT_35 - -
- (795727) 795727..795790 + 64 NuclAT_37 - -
- (795727) 795727..795790 + 64 NuclAT_37 - -
- (795727) 795727..795790 + 64 NuclAT_37 - -
- (795727) 795727..795790 + 64 NuclAT_37 - -
- (795727) 795727..795790 + 64 NuclAT_39 - -
- (795727) 795727..795790 + 64 NuclAT_39 - -
- (795727) 795727..795790 + 64 NuclAT_39 - -
- (795727) 795727..795790 + 64 NuclAT_39 - -
- (795725) 795725..795791 + 67 NuclAT_16 - Antitoxin
- (795725) 795725..795791 + 67 NuclAT_16 - Antitoxin
- (795725) 795725..795791 + 67 NuclAT_16 - Antitoxin
- (795725) 795725..795791 + 67 NuclAT_16 - Antitoxin
- (795725) 795725..795791 + 67 NuclAT_18 - Antitoxin
- (795725) 795725..795791 + 67 NuclAT_18 - Antitoxin
- (795725) 795725..795791 + 67 NuclAT_18 - Antitoxin
- (795725) 795725..795791 + 67 NuclAT_18 - Antitoxin
- (795725) 795725..795791 + 67 NuclAT_20 - Antitoxin
- (795725) 795725..795791 + 67 NuclAT_20 - Antitoxin
- (795725) 795725..795791 + 67 NuclAT_20 - Antitoxin
- (795725) 795725..795791 + 67 NuclAT_20 - Antitoxin
- (795725) 795725..795791 + 67 NuclAT_22 - Antitoxin
- (795725) 795725..795791 + 67 NuclAT_22 - Antitoxin
- (795725) 795725..795791 + 67 NuclAT_22 - Antitoxin
- (795725) 795725..795791 + 67 NuclAT_22 - Antitoxin
- (795725) 795725..795791 + 67 NuclAT_24 - Antitoxin
- (795725) 795725..795791 + 67 NuclAT_24 - Antitoxin
- (795725) 795725..795791 + 67 NuclAT_24 - Antitoxin
- (795725) 795725..795791 + 67 NuclAT_24 - Antitoxin
- (795725) 795725..795791 + 67 NuclAT_26 - Antitoxin
- (795725) 795725..795791 + 67 NuclAT_26 - Antitoxin
- (795725) 795725..795791 + 67 NuclAT_26 - Antitoxin
- (795725) 795725..795791 + 67 NuclAT_26 - Antitoxin
- (795727) 795727..795792 + 66 NuclAT_41 - -
- (795727) 795727..795792 + 66 NuclAT_41 - -
- (795727) 795727..795792 + 66 NuclAT_41 - -
- (795727) 795727..795792 + 66 NuclAT_41 - -
I6K20_RS04070 (796105) 796105..796212 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (796265) 796265..796326 + 62 NuclAT_28 - -
- (796265) 796265..796326 + 62 NuclAT_28 - -
- (796265) 796265..796326 + 62 NuclAT_28 - -
- (796265) 796265..796326 + 62 NuclAT_28 - -
- (796265) 796265..796326 + 62 NuclAT_30 - -
- (796265) 796265..796326 + 62 NuclAT_30 - -
- (796265) 796265..796326 + 62 NuclAT_30 - -
- (796265) 796265..796326 + 62 NuclAT_30 - -
- (796265) 796265..796326 + 62 NuclAT_32 - -
- (796265) 796265..796326 + 62 NuclAT_32 - -
- (796265) 796265..796326 + 62 NuclAT_32 - -
- (796265) 796265..796326 + 62 NuclAT_32 - -
- (796265) 796265..796326 + 62 NuclAT_34 - -
- (796265) 796265..796326 + 62 NuclAT_34 - -
- (796265) 796265..796326 + 62 NuclAT_34 - -
- (796265) 796265..796326 + 62 NuclAT_34 - -
- (796265) 796265..796326 + 62 NuclAT_36 - -
- (796265) 796265..796326 + 62 NuclAT_36 - -
- (796265) 796265..796326 + 62 NuclAT_36 - -
- (796265) 796265..796326 + 62 NuclAT_36 - -
- (796265) 796265..796326 + 62 NuclAT_38 - -
- (796265) 796265..796326 + 62 NuclAT_38 - -
- (796265) 796265..796326 + 62 NuclAT_38 - -
- (796265) 796265..796326 + 62 NuclAT_38 - -
- (796265) 796265..796327 + 63 NuclAT_17 - -
- (796265) 796265..796327 + 63 NuclAT_17 - -
- (796265) 796265..796327 + 63 NuclAT_17 - -
- (796265) 796265..796327 + 63 NuclAT_17 - -
- (796265) 796265..796327 + 63 NuclAT_19 - -
- (796265) 796265..796327 + 63 NuclAT_19 - -
- (796265) 796265..796327 + 63 NuclAT_19 - -
- (796265) 796265..796327 + 63 NuclAT_19 - -
- (796265) 796265..796327 + 63 NuclAT_21 - -
- (796265) 796265..796327 + 63 NuclAT_21 - -
- (796265) 796265..796327 + 63 NuclAT_21 - -
- (796265) 796265..796327 + 63 NuclAT_21 - -
- (796265) 796265..796327 + 63 NuclAT_23 - -
- (796265) 796265..796327 + 63 NuclAT_23 - -
- (796265) 796265..796327 + 63 NuclAT_23 - -
- (796265) 796265..796327 + 63 NuclAT_23 - -
- (796265) 796265..796327 + 63 NuclAT_25 - -
- (796265) 796265..796327 + 63 NuclAT_25 - -
- (796265) 796265..796327 + 63 NuclAT_25 - -
- (796265) 796265..796327 + 63 NuclAT_25 - -
- (796265) 796265..796327 + 63 NuclAT_27 - -
- (796265) 796265..796327 + 63 NuclAT_27 - -
- (796265) 796265..796327 + 63 NuclAT_27 - -
- (796265) 796265..796327 + 63 NuclAT_27 - -
- (796265) 796265..796328 + 64 NuclAT_40 - -
- (796265) 796265..796328 + 64 NuclAT_40 - -
- (796265) 796265..796328 + 64 NuclAT_40 - -
- (796265) 796265..796328 + 64 NuclAT_40 - -
I6K20_RS04075 (796618) 796618..797718 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
I6K20_RS04080 (797988) 797988..798218 + 231 WP_001146444.1 putative cation transport regulator ChaB -
I6K20_RS04085 (798376) 798376..799071 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
I6K20_RS04090 (799115) 799115..799468 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T192825 WP_000170965.1 NZ_CP070048:c795677-795570 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T192825 NZ_CP092554:2726480-2726737 [Staphylococcus aureus]
ATGATTAAGGCTTGGTCTGATGATGCTTGGGATGATTATCTTTATTGGCATGAGCAAGGAAACAAAAGCAATATAAAAAA
GATTAACAAGTTAATAAAAGATATCGATCGTTCCCCCTTTGCTGGATTAGGAAAACCTGAGCCATTAAAGCATGATTTAT
CTGGAAAATGGTCCAGAAGAATTACAGATGAACATAGACTGATATATAGAGTTGAAAATGAAACGATATTTATTTATTCT
GCAAAAGATCACTATTAA

Antitoxin


Download         Length: 67 bp

>AT192825 NZ_CP070048:795725-795791 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References