Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1311655..1311876 Replicon chromosome
Accession NZ_CP070045
Organism Escherichia coli strain FDAARGOS_1303

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag I6K33_RS07005 Protein ID WP_000170954.1
Coordinates 1311655..1311762 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1311815..1311876 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I6K33_RS06980 (1307500) 1307500..1308582 + 1083 WP_000804726.1 peptide chain release factor 1 -
I6K33_RS06985 (1308582) 1308582..1309415 + 834 WP_000456474.1 peptide chain release factor N(5)-glutamine methyltransferase -
I6K33_RS06990 (1309412) 1309412..1309804 + 393 WP_000200375.1 invasion regulator SirB2 -
I6K33_RS06995 (1309808) 1309808..1310617 + 810 WP_001257054.1 invasion regulator SirB1 -
I6K33_RS07000 (1310653) 1310653..1311507 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
I6K33_RS07005 (1311655) 1311655..1311762 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1311815) 1311815..1311876 + 62 NuclAT_12 - Antitoxin
- (1311815) 1311815..1311876 + 62 NuclAT_12 - Antitoxin
- (1311815) 1311815..1311876 + 62 NuclAT_12 - Antitoxin
- (1311815) 1311815..1311876 + 62 NuclAT_12 - Antitoxin
- (1311815) 1311815..1311876 + 62 NuclAT_13 - Antitoxin
- (1311815) 1311815..1311876 + 62 NuclAT_13 - Antitoxin
- (1311815) 1311815..1311876 + 62 NuclAT_13 - Antitoxin
- (1311815) 1311815..1311876 + 62 NuclAT_13 - Antitoxin
- (1311815) 1311815..1311876 + 62 NuclAT_14 - Antitoxin
- (1311815) 1311815..1311876 + 62 NuclAT_14 - Antitoxin
- (1311815) 1311815..1311876 + 62 NuclAT_14 - Antitoxin
- (1311815) 1311815..1311876 + 62 NuclAT_14 - Antitoxin
- (1311815) 1311815..1311876 + 62 NuclAT_15 - Antitoxin
- (1311815) 1311815..1311876 + 62 NuclAT_15 - Antitoxin
- (1311815) 1311815..1311876 + 62 NuclAT_15 - Antitoxin
- (1311815) 1311815..1311876 + 62 NuclAT_15 - Antitoxin
- (1311815) 1311815..1311876 + 62 NuclAT_16 - Antitoxin
- (1311815) 1311815..1311876 + 62 NuclAT_16 - Antitoxin
- (1311815) 1311815..1311876 + 62 NuclAT_16 - Antitoxin
- (1311815) 1311815..1311876 + 62 NuclAT_16 - Antitoxin
- (1311815) 1311815..1311876 + 62 NuclAT_17 - Antitoxin
- (1311815) 1311815..1311876 + 62 NuclAT_17 - Antitoxin
- (1311815) 1311815..1311876 + 62 NuclAT_17 - Antitoxin
- (1311815) 1311815..1311876 + 62 NuclAT_17 - Antitoxin
- (1311815) 1311815..1311877 + 63 NuclAT_10 - -
- (1311815) 1311815..1311877 + 63 NuclAT_10 - -
- (1311815) 1311815..1311877 + 63 NuclAT_10 - -
- (1311815) 1311815..1311877 + 63 NuclAT_10 - -
- (1311815) 1311815..1311877 + 63 NuclAT_11 - -
- (1311815) 1311815..1311877 + 63 NuclAT_11 - -
- (1311815) 1311815..1311877 + 63 NuclAT_11 - -
- (1311815) 1311815..1311877 + 63 NuclAT_11 - -
- (1311815) 1311815..1311877 + 63 NuclAT_6 - -
- (1311815) 1311815..1311877 + 63 NuclAT_6 - -
- (1311815) 1311815..1311877 + 63 NuclAT_6 - -
- (1311815) 1311815..1311877 + 63 NuclAT_6 - -
- (1311815) 1311815..1311877 + 63 NuclAT_7 - -
- (1311815) 1311815..1311877 + 63 NuclAT_7 - -
- (1311815) 1311815..1311877 + 63 NuclAT_7 - -
- (1311815) 1311815..1311877 + 63 NuclAT_7 - -
- (1311815) 1311815..1311877 + 63 NuclAT_8 - -
- (1311815) 1311815..1311877 + 63 NuclAT_8 - -
- (1311815) 1311815..1311877 + 63 NuclAT_8 - -
- (1311815) 1311815..1311877 + 63 NuclAT_8 - -
- (1311815) 1311815..1311877 + 63 NuclAT_9 - -
- (1311815) 1311815..1311877 + 63 NuclAT_9 - -
- (1311815) 1311815..1311877 + 63 NuclAT_9 - -
- (1311815) 1311815..1311877 + 63 NuclAT_9 - -
- (1311815) 1311815..1311878 + 64 NuclAT_18 - -
- (1311815) 1311815..1311878 + 64 NuclAT_18 - -
- (1311815) 1311815..1311878 + 64 NuclAT_18 - -
- (1311815) 1311815..1311878 + 64 NuclAT_18 - -
- (1311815) 1311815..1311878 + 64 NuclAT_19 - -
- (1311815) 1311815..1311878 + 64 NuclAT_19 - -
- (1311815) 1311815..1311878 + 64 NuclAT_19 - -
- (1311815) 1311815..1311878 + 64 NuclAT_19 - -
- (1311815) 1311815..1311878 + 64 NuclAT_20 - -
- (1311815) 1311815..1311878 + 64 NuclAT_20 - -
- (1311815) 1311815..1311878 + 64 NuclAT_20 - -
- (1311815) 1311815..1311878 + 64 NuclAT_20 - -
- (1311815) 1311815..1311878 + 64 NuclAT_21 - -
- (1311815) 1311815..1311878 + 64 NuclAT_21 - -
- (1311815) 1311815..1311878 + 64 NuclAT_21 - -
- (1311815) 1311815..1311878 + 64 NuclAT_21 - -
- (1311815) 1311815..1311878 + 64 NuclAT_22 - -
- (1311815) 1311815..1311878 + 64 NuclAT_22 - -
- (1311815) 1311815..1311878 + 64 NuclAT_22 - -
- (1311815) 1311815..1311878 + 64 NuclAT_22 - -
- (1311815) 1311815..1311878 + 64 NuclAT_23 - -
- (1311815) 1311815..1311878 + 64 NuclAT_23 - -
- (1311815) 1311815..1311878 + 64 NuclAT_23 - -
- (1311815) 1311815..1311878 + 64 NuclAT_23 - -
I6K33_RS07010 (1312168) 1312168..1313268 - 1101 WP_001313768.1 sodium-potassium/proton antiporter ChaA -
I6K33_RS07015 (1313538) 1313538..1313768 + 231 WP_001146444.1 putative cation transport regulator ChaB -
I6K33_RS07020 (1313926) 1313926..1314621 + 696 WP_000632706.1 glutathione-specific gamma-glutamylcyclotransferase -
I6K33_RS07025 (1314665) 1314665..1315018 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
I6K33_RS07030 (1315203) 1315203..1316597 + 1395 WP_000086194.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T192779 WP_000170954.1 NZ_CP070045:c1311762-1311655 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T192779 NZ_CP092542:c1863229-1863077 [Staphylococcus aureus]
ATGTCTAAAGACAAAGATCCAAAATTAAATTATCATGAAGAAGAAAACAGTATGGTAACGGATTTTGAAGATTTAAAAGA
ATTAGGTAAAGAAATGGAACAAATCTCTGATCAAAATGATCAAGAAAAAAATTCTGAAGAAGACAGTCAGTAA

Antitoxin


Download         Length: 62 bp

>AT192779 NZ_CP070045:1311815-1311876 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References